KEGG   Dickeya fangzhongdai ND14b: LH89_18975Help
Entry
LH89_18975        CDS       T03347                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ced  Dickeya fangzhongdai ND14b
Pathway
ced02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ced00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LH89_18975 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ced02000]
    LH89_18975 (pstB)
Enzymes [BR:ced01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     LH89_18975 (pstB)
Transporters [BR:ced02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    LH89_18975 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_22 RsgA_GTPase AAA_16 SMC_N AAA_23 AAA_29 Rad17 AAA_25 AAA_33 AAA_15 AAA_30 AAA_5 TniB NACHT AAA_24
Motif
Other DBs
NCBI-ProteinID: AIR71184
LinkDB All DBs
Position
4250876..4251691
Genome map
AA seq 271 aa AA seqDB search
MGMPKQLERLPVMDVHRLTDDQTALSVDGLNLYYGDKQALSDISLRIPKHRVTALIGPSG
CGKSTLLRCFNRMNDLMDTCRIEGDIRLQGMPINDPAVDVSTLRRRVGMVFQRPNPFPKS
IYENVIYGLRLQGVKDRRMLDEAVENALRAAALWHEVKDRLGDNALTLSSGQQQRLVIAR
AIAIEPEVLLLDEPTSALDPISTLVIEELIGALKRRFTLVLVTHNMQQAARVSDYTAFIH
HGRLIEYNETDALFTAPAERRTEDYITGRFG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcctaaacagctggaacgactccccgtgatggacgtccaccggttgacggat
gatcaaacggctttgtcggtagacgggctgaatctgtattacggcgacaagcaggcgctg
agcgatatatccctgcgtattccgaaacaccgcgtgaccgcgttgattgggccgtccggg
tgcggtaaatccaccttgttgcgttgctttaaccgcatgaacgacctgatggatacgtgt
cgcattgaaggcgatatccgtctgcaaggcatgcccatcaacgatccggcggtggatgtg
tcgacgctgcgccgccgggtcggcatggtatttcagcgccccaatccattccccaaatcc
atctatgaaaacgtgatttacggcctgcgtctgcagggcgtgaaagaccggcgtatgctg
gatgaagcggtggaaaatgcgctgcgggccgcggccttgtggcatgaggtaaaagaccgg
cttggcgacaatgcgctgacgctctccagcggccagcagcagcggctggtgatcgcccgc
gccatcgccatcgaaccggaggtgctgttgctggatgaacccacctcggcgctcgatccg
atctcgacgctggtgatcgaagaactgatcggcgcgctgaaacgccgctttacgctggtg
ctggtgacccacaacatgcagcaggcggcgcgggtgtccgattatacggcgtttattcat
catggccggctgattgaatataacgaaaccgatgcgctgtttaccgctccggccgaacgc
cgtaccgaagactatattaccggtcgtttcggttaa

DBGET integrated database retrieval system