KEGG   Corynebacterium efficiens: CE0517Help
Entry
CE0517            CDS       T00103                                 

Definition
(GenBank) putative translation elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
cef  Corynebacterium efficiens
Brite
KEGG Orthology (KO) [BR:cef00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cef03012]
    CE0517
   03029 Mitochondrial biogenesis [BR:cef03029]
    CE0517
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cef04147]
    CE0517
Translation factors [BR:cef03012]
 Eukaryotic Type
  Elongation factors
   CE0517
 Prokaryotic Type
   CE0517
Mitochondrial biogenesis [BR:cef03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CE0517
Exosome [BR:cef04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CE0517
  Exosomal proteins of breast cancer cells
   CE0517
  Exosomal proteins of colorectal cancer cells
   CE0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAC17327
NITE: CE0517
UniProt: Q8FS84
LinkDB All DBs
Position
556746..557936
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLADAYPELNEAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGDEKWAGQILELMQACDDNIPDPVRETDKPFLMPIEDIFTITGRGTVVTGRVERGTLNV
NDDVEIIGIKEKATQTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDVERGQVVVKPGA
YTPHTEFEGSVYVLSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGVEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGSRTVGAGRVTKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaccaagccccacgtaaacatcggcaccatcggtcac
gttgaccacggtaagaccaccaccaccgcggctatcaccaaggttctggctgacgcttac
cctgaactcaacgaggctttcgccttcgacgcgatcgacaaggctccagaggagaaggag
cgtggcatcacgatcaacatctcccacgttgagtaccagaccgagaagcgccactacgca
cacgtcgacgcaccgggccacgccgactacatcaagaacatgatcaccggcgcagctcag
atggacggcgcaatcctcgttgttgcagctaccgacggcccaatgccacagacccgtgag
cacgttcttcttgctcgccaggttggcgttccttacatcctcgttgctctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaagttcgcgaacttctt
gctgagcaggactacgacgaagatgctccaatcgttcacatctccgctctgaaggctctt
gagggcgacgagaagtgggctggccagatcctcgagctcatgcaggcttgcgatgacaac
atcccagacccagttcgtgagaccgacaagccattcctcatgcctatcgaggacatcttc
accatcaccggtcgtggcaccgttgttaccggtcgtgttgagcgcggtaccctgaacgtc
aacgacgatgtcgagatcatcggcatcaaggagaaggcaactcagaccaccgtcaccggt
atcgagatgttccgcaagctccttgactccgctgaggccggcgacaactgtggtctgctg
ctccgcggtatcaagcgcgaggacgttgagcgtggccaggttgtcgtcaagccaggcgct
tacacccctcacaccgagttcgagggctctgtctacgtcctgtccaaggatgagggtggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtt
accggtgttgtgaagctgcctgagggcgtcgagatggtcatgccaggcgacaacgtcgac
atgtccgtcaccctgatccagcctgtcgcaatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgttggcgccggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system