KEGG   Corynebacterium efficiens: CE1431Help
Entry
CE1431            CDS       T00103                                 

Definition
(GenBank) putative D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cef  Corynebacterium efficiens
Pathway
cef00473  D-Alanine metabolism
cef00550  Peptidoglycan biosynthesis
cef01100  Metabolic pathways
cef01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cef00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CE1431
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CE1431
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CE1431
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cef01011]
    CE1431
Enzymes [BR:cef01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CE1431
Peptidoglycan biosynthesis and degradation proteins [BR:cef01011]
 Precursor biosynthesis
  Amino acid ligase
   CE1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAC18241
NITE: CE1431
UniProt: Q8FPQ9
LinkDB All DBs
Position
1500784..1501869
Genome map
AA seq 361 aa AA seqDB search
MSNSNSAKVRVAVLYGGRSAEHSVSCVSAGAIIAHLDPEKYEVIPVGITTDGAWVVGESD
PERLRLVDRTMPEVQRREEIRPSLDPAHRGEFHFADGSLYATADVIFPVLHGRFGEDGTI
QGMFALSDIPVVGPGVLSSAAGMDKEFTKKLMAAEGLPIGREVILRDRAELTDAEKKLLG
LPVFVKPARGGSSIGISKVSRWEDLPAAVDLARQHDEKVIVESEIVGPEVECGVLQYPDG
RIVASLPAMLRGTEDGEGGFYDFDTKYLDNVVTAEIPAPLDEEIIELVQSLAVETFQALA
CEGLARVDFFVTANGPVLNEINTMPGFTPISMYPQMFAASGVGYEELLDVLVQQALHRSS
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaactcaaattccgccaaagtccgcgtcgccgttctctatggtggccgcagcgcc
gagcactcggtgtcgtgtgtgtccgccggtgccatcatcgcgcaccttgatcccgagaag
tatgaggtcatccccgtcggtatcaccacggatggcgcctgggtggtcggcgaatccgat
ccggagcgtctgcgcctggtcgaccgcaccatgcccgaggtgcagcgccgggaggagatc
cgccccagcctggatcccgcccaccgcggtgagttccacttcgccgacgggtccctctat
gccaccgcggatgtcatcttcccggtgctgcacggtcgtttcggtgaggacggcaccatc
cagggcatgttcgccctgtcggacatccccgtggtggggccgggtgtgctgtcctcggct
gcgggtatggataaggagttcaccaaaaagctcatggccgcggagggcctgccgatcggc
cgtgaggtcatcctgcgtgatcgcgccgagctgaccgacgcggagaagaagctgctgggc
ctgcccgtcttcgtcaaacccgcccggggtggttcctccatcggtatctccaaggtgagc
cggtgggaggatcttcctgctgccgtcgacctggcacgccagcatgatgagaaggtcatc
gtcgaatccgagatcgtcggccccgaggtcgagtgcggtgtgctgcagtacccggatggc
cgcatcgtggcctcgctcccggcgatgctgcgcggcaccgaggacggcgagggtggtttc
tacgacttcgacaccaagtacctcgacaatgtggttaccgcggagatcccggcacccctt
gatgaggagatcattgaactggtgcagtccctggccgtggaaaccttccaggccctggcc
tgcgagggtctggcgcgcgtggatttcttcgtcaccgccaacggccccgttctcaatgag
atcaacaccatgccgggtttcaccccgatctccatgtacccgcagatgttcgctgcgtcc
ggggtgggctacgaggagcttctcgacgtcctcgtccagcaggcactgcaccgctccagc
aactag

DBGET integrated database retrieval system