KEGG   Cellvibrio sp. KY-GH-1: D0C16_13780Help
Entry
D0C16_13780       CDS       T06422                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ceg  Cellvibrio sp. KY-GH-1
Brite
KEGG Orthology (KO) [BR:ceg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0C16_13780
Enzymes [BR:ceg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0C16_13780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C FAD_binding_3 Glutaredoxin DAO Thi4 FMO-like NAD_binding_7 K_oxygenase NAD_binding_8 Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QEY16948
UniProt: A0A5J6P8S4
LinkDB All DBs
Position
complement(3158337..3159902)
Genome map
AA seq 521 aa AA seqDB search
MLDAAIKGQLKAYLEKLQRPIQLVASLDESSKSEELNNLLLDIATLSGKVSVSNLGNAAY
RPSFSIAALGEAPRIEFAGIPMGHEFTSLVLALLQTGGHPPKVDAKTIEQIRAIEGKFHF
EVFVSLSCHNCPDVVQAVNLLAAINPNFSATMIDGALFQNEVEQRKVMAVPSVYLNGEHF
GQGRMTLEEIIAKIDTGAAERDAKALGEKDPFDVLVIGGGPAGAAAAIYSARKGIRTGVV
AERFGGQVLDTVGIENFISVKATEGPKLAMALEQHVKEYDVDVMNLQKAAEVIPGNNPGD
LVEVKLASGASVKSKSVILATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAQVTLIEFDSKLRADAVLQRKLFSLPNVTVITEALTSEVVGNG
EKVTALKYKSRNTDEIATVELDGIFVQIGLLPNTDFLKGTVQLTNRGEIEINARGETSVP
GVFAAGDCTNVPYKQIIIAMGAGASASLGAFDYLIRTSSPC
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgctgcgattaaaggccaactcaaagcctatttggaaaaactgcaacgcccc
atccaactggttgctagcctggatgagagttcaaaaagcgaagagttaaataatcttttg
ttagacattgcgacgctgtctggaaaagtgagtgtaagtaatctgggtaacgccgcgtat
cgcccatcattttctattgctgcactgggtgaagcaccgcgaattgaatttgcgggaatt
cccatggggcacgaatttacctcgctggtgttggccttattgcaaaccggcggacatcca
cccaaggtggatgcaaaaaccattgaacaaattagagcaattgagggcaaatttcatttt
gaagtgtttgtctcgctctcctgccacaactgcccggacgtagtgcaggccgtaaatttg
ttggcagcgatcaacccgaatttttcagccactatgatcgatggcgcgctttttcaaaac
gaagtcgagcagcgtaaagtcatggcggttcccagtgtgtatttgaatggtgagcatttc
ggacagggccgtatgacgctggaagaaattatcgcgaaaattgataccggcgcggccgag
cgcgatgccaaagccttgggtgaaaaagatccgtttgatgtattggttattggcggtggc
cctgcgggcgcagcggcggcgatttattccgcgcgtaaaggcattcgcaccggtgtagtg
gccgagcgttttggtgggcaagtgttagatacagtcggcattgaaaactttatttccgtg
aaagcgacagaaggcccgaaattggccatggcgctggagcagcacgttaaagaatacgat
gtggatgtaatgaatctgcaaaaagcggcggaggttattcctggtaataatcccggtgat
ctggtggaagtcaaactcgccagcggtgccagcgttaaaagtaaaagcgtgattctcgcc
actggcgcacgctggagagagatgaatgttcccggcgagcaagaatatcgcggcaaaggc
gtagcctactgcccacattgcgatggccctttatttaaaggcaaacgcgtagcagtgatt
ggtggtggcaactcaggcgtggaagcggcgattgatttggcgggaattgtggctcaggta
accctgattgaattcgattcaaagttgcgtgcagatgcagtattgcagcgcaaattattc
agcttgcccaacgtaacagtgatcaccgaagccttaacctctgaggtggtcggcaatggc
gagaaagttacggcgctgaaatacaaaagccgcaataccgatgaaatcgccactgtggaa
ctggacggtatttttgtgcaaatcggtctgctgcccaataccgatttcttaaaaggcaca
gtgcagctgacgaatcgcggtgaaattgaaatcaatgcgcgcggagagacgtcagtgcct
ggtgtatttgccgcgggcgattgtaccaacgtgccctacaagcaaatcattatcgccatg
ggggccggtgccagcgcctctttgggcgcgtttgattatctgattcgtaccagtagcccg
tgctaa

DBGET integrated database retrieval system