KEGG   Celeribacter ethanolicus: CEW89_00240Help
Entry
CEW89_00240       CDS       T05094                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00970  Aminoacyl-tRNA biosynthesis
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CEW89_00240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ceh03029]
    CEW89_00240
Enzymes [BR:ceh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CEW89_00240
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CEW89_00240
Mitochondrial biogenesis [BR:ceh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CEW89_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N YqeY
Motif
Other DBs
NCBI-ProteinID: ATG46138
UniProt: A0A291G7N6
LinkDB All DBs
Position
complement(52012..53529)
Genome map
AA seq 505 aa AA seqDB search
MLDHLEYSAPKPKVISGAKEDWELVIGMEIHAQVASEAKLFSGASTGFGAEPNSHVSFVD
AAMPGMLPVINEYCVEQAVRTGLGLKADINLFSAFDRKNYFYPDLPQGYQISQLYHPIVG
EGEVIVDMEPGVARKVRIERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVSRPDIR
GPEEAAAYVLKLRQILRYLGTCDGNMQNGNLRADVNVSVCRPGQYEKYQETQDFSHLGTR
CEIKNMNSTRFIQAAIDYEARRQIAILEDGGTVDQETRLYDAAKNETRSMRSKEEAHDYR
YFPCPDLLPLEIEQAWVDDIAKTLPELPDEKKARFVKDFGLSEYDAGVLTADTVNADFFE
KVVAVGEDGKLSANWVINELFGRLKKDDTDITESPVTPEQLGEIVKLIKADTISGKIAKD
LFEIVYTEGGNPAEIVEARGMKQVTDTGAIEAAVDEIIAANPAQVEKAKANPKLAGWFVG
QVMKATGGKANPKAVDALVKSKLGL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcatctcgaatattccgcaccgaaaccgaaggtcatctccggtgcgaaagaa
gactgggaactcgtgatcgggatggaaatccatgcgcaggtcgcctccgaggcgaagctg
ttttccggcgcgtccaccggtttcggcgcagaacccaactcgcatgtgtccttcgtggat
gcggcgatgccgggcatgttgccggtgatcaacgaatattgcgtcgaacaggcggtgcgc
accgggctgggcctcaaggccgacatcaacctgttctccgcctttgaccgcaagaactac
ttctaccccgacctgccgcagggctatcagatttcccagctttaccacccgatcgtgggc
gaaggtgaagtgatcgtagatatggagccgggtgtcgcccgcaaggtgcggatcgagcgc
attcacctcgaacaggacgccggcaagtcgatccacgacatggacccgacgatgtctttc
gtcgacctgaaccgcaccggtgtggcgctgatggagatcgtctcgcgccccgatattcgc
gggccggaagaggccgccgcttacgtgctgaaactgcgccagatcctgcgctacttgggc
acctgcgatggcaacatgcagaacggcaacctgcgcgccgacgtgaacgtgtcggtctgt
cgtccgggtcagtatgagaaataccaagagacgcaggatttctcgcatctcggcacccgt
tgcgagatcaagaacatgaactccacgcgcttcattcaggccgccatcgactatgaggcc
cgtcgccagatcgccattctcgaagacggcggcacggtcgatcaggaaacccgtctctat
gacgcggccaagaacgaaacccgttcgatgcgctcgaaagaagaggcgcatgactaccgc
tatttcccctgccccgacttgctcccgctggagatcgaacaggcgtgggtggacgacatc
gccaaaaccctgccggaactgccggacgagaagaaagcacgtttcgtcaaggacttcggc
ctgtcggaatatgacgcgggcgtcttgaccgccgacacggtgaacgccgatttcttcgag
aaagtcgtggcggtcggcgaggatggcaagctctccgccaactgggtgattaacgagctg
ttcggtcgcctgaaaaaggacgacaccgacatcacggaaagcccggttacaccggagcaa
ctgggcgaaatcgtcaagctgatcaaggcggacacgatctccggcaagatcgccaaagac
ctcttcgaaatcgtctacaccgaaggcggcaaccccgccgagatcgtcgaagcgcgcggc
atgaaacaggtgacggacaccggcgccatcgaggccgccgtggatgagatcatcgcggcc
aacccggcacaggtcgagaaagccaaagccaacccgaaactcgcgggctggttcgtcggt
caggtaatgaaagccaccggcggcaaggccaacccgaaagcggtggacgcgctggtcaaa
tccaaactcggcctttga

DBGET integrated database retrieval system