KEGG   Celeribacter ethanolicus: CEW89_03555Help
Entry
CEW89_03555       CDS       T05094                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00250  Alanine, aspartate and glutamate metabolism
ceh00410  beta-Alanine metabolism
ceh00640  Propanoate metabolism
ceh00650  Butanoate metabolism
ceh01100  Metabolic pathways
ceh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CEW89_03555 (gabT)
   00650 Butanoate metabolism
    CEW89_03555 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CEW89_03555 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEW89_03555 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ceh01007]
    CEW89_03555 (gabT)
Enzymes [BR:ceh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CEW89_03555 (gabT)
Amino acid related enzymes [BR:ceh01007]
 Aminotransferase (transaminase)
  Class III
   CEW89_03555 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATG46714
UniProt: A0A291G9H0
LinkDB All DBs
Position
complement(715576..716862)
Genome map
AA seq 428 aa AA seqDB search
MLKSTANTEIESRRKAALARGVGVLTDHYAVKAENSEIWDEDGNRLIDFASGIAVLNTGH
RHPKVIAAVEKQLASFTHTCHQVVPYEPYVRLAERLNALAPGDFDKKSLFVTTGAEALEN
AVKIARAATGRSAVITFNGGFHGRTFMTMSMTGKVVPYKVGFGPMAADVFHAPYPNALHG
ISVDDSLNAIEHLFKADVDPARVAAIVFEPVQGEGGFNPAPKEFVERIRKLCDDKGIVMV
ADEVQTGFARTGTVFAMEAYGIAPDLTTMAKSLGGGFPISAVVGKAEIMDAAGPGGLGGT
YGGNPLAIAAANAVLDVIEEEKLCDRANTLGDTLKARLEALKADVPEIVEVRGPGFMVAA
EFCHADGTPAPELANAIRVEALNRGLLLLTCGVYGNVIRFLAPITIQDDVFAEALDILEN
AAKAAKGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaatcgactgcaaataccgaaatcgaatcccgtcgcaaggcggctctggcccgc
ggcgtgggcgtactcaccgaccattatgcggtgaaagcggaaaactcggaaatctgggac
gaagatggcaatcgcctgatcgacttcgcctccggcatcgccgtgctgaacaccggccac
cgccacccgaaggtcatcgcagcggtcgagaagcagctcgcctccttcacccatacctgc
caccaagtggtgccctatgaaccctatgttcgtctcgccgagcgcctgaacgcgctggct
cctggggactttgacaagaaatccctctttgtcacgactggcgcagaagcacttgaaaat
gccgtgaaaatcgcgcgtgcggccacgggtcgatcggcggtgatcaccttcaacggcggc
ttccatggcaggactttcatgaccatgtcgatgaccggcaaggtggtgccgtacaaagtc
ggtttcggcccaatggccgccgacgtgttccacgcgccctaccccaacgcgctgcatggc
atctccgttgacgacagcctgaatgccatcgagcacctgttcaaggcggatgtcgatccg
gcccgagtcgcggccatcgtgttcgaacccgtgcaaggcgaaggcggcttcaacccggcc
ccgaaagaattcgtcgaacgtattcgcaagctctgtgacgataagggcatcgtgatggtc
gccgacgaggtgcaaaccggctttgcccgcaccggcaccgtgttcgcgatggaggcttac
ggcatcgcgccggatctcaccaccatggcgaaaagccttggcggtggcttcccgatctct
gccgtggtcggcaaggccgagatcatggacgcggccggtccgggcggtctgggcggcacc
tatggcggcaacccgctggcgattgcggcggcgaacgccgtgctcgacgtcatcgaagaa
gaaaagctttgcgaccgcgccaatacgctcggtgatacgctgaaagcccgtctcgaagcg
ctgaaagccgatgtgccggagatcgtcgaagtgcgcggtccgggcttcatggtcgcggcc
gaattctgccacgccgacggcacccctgccccggaactggcgaatgcgatccgggtcgag
gcgcttaaccgtggcctgcttctgctgacctgcggcgtctatggcaacgtgatccgcttc
ctcgcgccgatcaccattcaggacgatgtgtttgcagaagcgctcgatatcctcgaaaac
gctgccaaagcggcaaaaggactctga

DBGET integrated database retrieval system