KEGG   Celeribacter ethanolicus: CEW89_11865Help
Entry
CEW89_11865       CDS       T05094                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00970  Aminoacyl-tRNA biosynthesis
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CEW89_11865
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ceh03029]
    CEW89_11865
Enzymes [BR:ceh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CEW89_11865
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CEW89_11865
Mitochondrial biogenesis [BR:ceh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CEW89_11865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ATG48199
UniProt: A0A291GCS7
LinkDB All DBs
Position
complement(2414672..2416000)
Genome map
AA seq 442 aa AA seqDB search
MVEYTEMSMSDLGRAIGTGDVDPRDLAAAFLDMAKAHPFADRIYARMMEGRAMAEAEAAY
GRARDGVRRGLLDGVPVSWKDLFDTAGVATEAGSALLKDRVPLRDAEVLRRASNAGLVAL
GKTHMSELAFSGLGLNPVTATTPCVNDHAAVSGGSSSGAAGSVAFGLAPGAIGSDTGGSV
RIPSAWNDLVGLKTTAGRIPLEGVVPLAAAFDTIGPLVKTVEDAAEVLAILDGSPAPDLK
GATLKGKRLLVLENVVFDDIRDAPLDAFEASVQKFREAGAEVTRAEVPAVTEAMDLSGIL
FTTEAYAEWREVIEANPDVMYPRILERFRAGGAFNGADFVAGWKKLAHLRADYLKATAGY
DAVILPTAPILPPNAERLMTDAEYYVTENLLALRNTRVGNLMGLTALTLPTGVPSCGVIL
QTPPMSEARLLRLGKAAETALT
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagtatacagagatgagcatgagcgatctggggcgggccatcggcacgggcgat
gtcgatccgcgcgatctggcggcggcgtttctggatatggccaaggcgcatccttttgcg
gatcggatttatgcgcggatgatggaaggccgcgccatggcggaggcggaggcggcctat
gggcgtgcccgcgacggggtgcggcgcgggcttttggacggggttcctgtgtcgtggaag
gacctgttcgacacggcgggcgtggcgacggaggccgggtcggctttgctgaaagaccgc
gtgccattgagggacgccgaagtgctccggcgtgcgtcgaacgcggggctcgtggcgctg
ggcaagacgcatatgtcggaattggcgttctccgggctggggcttaatccggtgacggcc
acgacgccctgcgtcaacgatcatgccgccgtgtcgggcgggtcgtcttcgggggcggcg
gggtctgtggcgtttggcctcgcgcccggtgcgatcgggtcggacaccggcgggtcggtg
cgtatcccctcggcgtggaacgatcttgtcgggctgaaaaccaccgcggggcgtattccg
ctggagggcgttgtgcctctggcggcggctttcgataccatcggcccgctggtcaagacg
gtggaagatgctgccgaagtgctcgccattctcgatgggtcgcctgcgcccgatctcaag
ggcgcgacgctcaagggcaagcgtttgctcgttctggaaaacgtggtcttcgacgacatt
cgcgacgcgcctctggatgcgtttgaggcgtcggtgcagaaattccgggaggccggggcc
gaggtgacgcgcgcggaggtgcccgcggtcaccgaagcgatggacctgtccggcattctg
tttaccaccgaggcctatgccgaatggcgcgaggtgatcgaggccaatcccgatgtgatg
tacccgcgcattcttgagcggttccgggcggggggcgcgttcaacggcgccgatttcgtg
gccggctggaagaaactcgcgcatctgcgggcggactatctcaaggcgacggcgggctat
gacgccgtcatcctgccgaccgcgccgatcctgccgcccaatgcggagcggctgatgacg
gatgcggagtattacgtcaccgagaaccttctggcgctgcgcaatacgcgggtcggcaac
ctgatggggctgaccgcgctgacacttccgacgggggttccgtcctgtggcgtgatcctg
caaacgccgccgatgagcgaagcgcggttgttgcgcttgggcaaggcggcggagaccgcg
ctgacctga

DBGET integrated database retrieval system