KEGG   Celeribacter ethanolicus: CEW89_16750Help
Entry
CEW89_16750       CDS       T05094                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00061  Fatty acid biosynthesis
ceh00780  Biotin metabolism
ceh01100  Metabolic pathways
ceh01130  Biosynthesis of antibiotics
ceh01212  Fatty acid metabolism
Module
ceh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CEW89_16750
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CEW89_16750
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CEW89_16750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ceh01004]
    CEW89_16750
Enzymes [BR:ceh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CEW89_16750
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CEW89_16750
Lipid biosynthesis proteins [BR:ceh01004]
 Fatty acid synthase
  Component type
   CEW89_16750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Maf KR
Motif
Other DBs
NCBI-ProteinID: ATG49070
UniProt: A0A291GG91
LinkDB All DBs
Position
complement(3409430..3410218)
Genome map
AA seq 262 aa AA seqDB search
MADLLKGKRGLVMGVANERSIAWGIAKACADEGAELAFTYQGEAFGKRLEPLASSVGSDT
MVDVDVTNPEQMDEAFAALKAKWGKLDFVVHAIAYSDKSELTGRFRDTTEANFKNSLHIS
CFSFIDVAKRASELMTEGGTLMTLTFAGSNMVVPNYNVMGVAKAALESSVRYLANDLGPE
GIRVNAISPGPMKTLAGSAIGGARRTYKHAEQNAPMQSNATLEAVGATAVYLASDGGAYT
TGEIIRVDGGYHIMGMPRIENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcttctcaaaggcaaacgcgggctcgtgatgggcgtcgccaacgagcgctcc
attgcctggggcatcgcgaaagcctgtgccgatgagggcgctgaactggcgttcacctat
cagggcgaggcctttggcaaacgtcttgaaccgctggcaagctctgttggctccgacacg
atggtcgatgtcgatgtgaccaacccggagcagatggacgaggccttcgcggcgctcaaa
gcgaaatggggcaagctcgatttcgtcgtccacgccatcgcctactcggacaaatccgaa
ctcaccggacgcttccgtgacaccaccgaggcaaatttcaagaattcgctgcatatctcg
tgtttcagcttcatcgatgtcgccaaacgcgcctccgagctgatgaccgagggcggcacc
ttgatgacgctgacatttgcgggctcgaacatggtcgtgccgaattacaacgtgatgggc
gtggccaaggcggcgctcgaatcttcggtgcgctacctcgccaacgatctcggccctgag
ggcatccgcgtcaacgcgatttcccccggtccgatgaaaacccttgcaggctctgccatc
ggtggcgcgcgccggacgtataagcacgccgaacaaaacgccccgatgcaatccaacgcc
acgctcgaagcagtcggcgccacggcggtctatctggcctctgacggcggcgcctacacc
accggcgagatcatccgcgtcgatggcggctatcacatcatgggcatgccccggatcgaa
aacctctga

DBGET integrated database retrieval system