KEGG   Celeribacter ethanolicus: CEW89_16760Help
Entry
CEW89_16760       CDS       T05094                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00061  Fatty acid biosynthesis
ceh00780  Biotin metabolism
ceh01100  Metabolic pathways
ceh01212  Fatty acid metabolism
Module
ceh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CEW89_16760
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CEW89_16760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ceh01004]
    CEW89_16760
Enzymes [BR:ceh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     CEW89_16760
Lipid biosynthesis proteins [BR:ceh01004]
 Fatty acid synthase
  Component type
   CEW89_16760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: ATG49072
UniProt: A0A291GG82
LinkDB All DBs
Position
complement(3411249..3412478)
Genome map
AA seq 409 aa AA seqDB search
MRRVVVTGLGIVSSIGNTAEEVLASLKTGKSGITANEDMKEYGFRSQVAGSIDIDIKEHV
DKRALRFMGPGAAYAYIAMKQAIADSGLEESEVVNPRTGLIAGSGGPSTSAMLTAHQSVL
NTKSTKRVGPFAVPKCMGSTISANLATAYQIKGINYSITSACSTSLHCIGSASEQIMMGK
QDVMFAGGGEELDWTLSCLFDAMGAMSSKYNDTPEKASRAFDANRDGFVISGGGAILVLE
ELEHAKARGAKIYAEVTGFAATSDGADMVAPSGEGGERAMRLALSTLEEGRKVGYINAHG
TSTPVGDVGEVEAVRRVFGEGQTPVISSTKSMTGHSQGATGAQEAVYCLLALQNDFIIPS
INVETLDPAIREGEIATKLVENAGLDTVMTNSFGFGGTNGSMLLSKYRN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtcgtcgtcaccgggttggggatcgtctcctccatcggcaatactgccgaa
gaggtgcttgcctctttgaaaaccgggaaatccggcatcaccgccaatgaggacatgaag
gaatacggcttccgctcgcaggtggccgggtccatcgacatcgacatcaaggaacatgtc
gacaagcgcgcgctgcgtttcatggggccgggggcagcctatgcctatatcgccatgaaa
caggcgattgccgactcgggcctcgaagagagcgaagtcgtgaacccgcgcaccggtctg
atcgctggctccggcggcccgtccacctccgccatgctgaccgcgcatcaatccgtgctc
aacaccaaatcgaccaagcgcgtcgggccgtttgccgtgccgaaatgcatggggtccacc
atctcggcaaacctcgcgaccgcctatcagatcaaggggatcaactactcgatcacctcg
gcctgctcgacctcgctgcattgcatcggctctgcctccgagcagatcatgatgggcaag
caagatgtgatgtttgcgggcggcggcgaagaactggactggacgctgtcctgcctgttc
gacgccatgggcgcgatgtcgtccaagtataacgacacgcccgagaaagcctcccgcgct
tttgacgccaaccgcgacggcttcgtgatctccggtggcggtgcgatcctcgtgctcgaa
gagctggaacacgccaaggcgcgcggcgcgaaaatctacgccgaagtcaccggctttgcc
gccacctccgacggcgccgacatggtcgccccctcgggcgaaggcggcgaacgggcgatg
cgtctggcgctttccacgctcgaagaaggccgcaaggtcggctacatcaatgcgcatggc
acctcgacccccgtcggcgacgtgggcgaagtcgaagccgtgcgtcgtgtctttggcgaa
ggtcagaccccggtgatttcctcgacgaaatccatgaccggccactctcagggcgccacc
ggcgcacaagaggccgtctattgtttgctggcgctgcaaaacgatttcatcatcccctcg
atcaacgtcgaaacgcttgatccggcgatccgcgagggtgagatcgccacgaaactggtg
gaaaatgcgggcctcgatacggtgatgaccaactcgtttgggttcggcggcaccaacggc
tcgatgcttttgtcgaaataccgcaactga

DBGET integrated database retrieval system