KEGG   Celeribacter ethanolicus: CEW89_16765Help
Entry
CEW89_16765       CDS       T05094                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00061  Fatty acid biosynthesis
ceh01100  Metabolic pathways
ceh01212  Fatty acid metabolism
Module
ceh_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CEW89_16765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ceh01004]
    CEW89_16765
Enzymes [BR:ceh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CEW89_16765
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CEW89_16765
Lipid biosynthesis proteins [BR:ceh01004]
 Fatty acid synthase
  Component type
   CEW89_16765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: ATG49073
UniProt: A0A291GEU7
LinkDB All DBs
Position
complement(3412522..3413031)
Genome map
AA seq 169 aa AA seqDB search
MADYPTSFTKEDLLKCAAGELFGPGNAQLPAPPMLMMDRITEISGDGGLHGKGHVVAEFD
ITPDLWFFECHFPGNPIMPGCLGLDGLWQLTGFNLGWRGWQGRGYALGVGEVKLTGMVRP
DRKMLTYKVDFKKAVQSRRLTMGVADGIVEADGEVIYQVTDMKVALSES
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggccgattaccccacgagtttcaccaaggaagacctgctcaaatgtgccgcgggcgag
ctctttggaccgggcaacgcgcaactcccggcgccgccgatgctgatgatggaccggatc
accgaaatttccggtgatggcgggctgcatggcaagggccatgtggtggcggaattcgac
atcacgccggatctgtggttcttcgaatgccatttccccggcaacccgatcatgcccggc
tgtctcggtctcgacgggttgtggcagctcaccgggttcaacctcggctggcgcggctgg
caggggcgtggctatgcgcttggcgtcggcgaagtgaagctcaccggcatggtgcgcccg
gatcggaagatgctgacctacaaggtcgatttcaagaaagccgtgcaaagccgccgcctg
accatgggcgtggccgacggcatcgtcgaagccgacggcgaagtgatctatcaggtcacc
gatatgaaggttgcgctgtccgagagctga

DBGET integrated database retrieval system