KEGG   Celeribacter ethanolicus: CEW89_18130Help
Entry
CEW89_18130       CDS       T05094                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ceh  Celeribacter ethanolicus
Pathway
ceh00240  Pyrimidine metabolism
ceh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CEW89_18130
Enzymes [BR:ceh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CEW89_18130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30
Motif
Other DBs
NCBI-ProteinID: ATG49325
UniProt: A0A291GGK4
LinkDB All DBs
Position
complement(3687103..3687684)
Genome map
AA seq 193 aa AA seqDB search
MAKLYFQYSTMNAGKSTLLLQASYNYRERGMDTYLITAKFDKRAGEGRIGSRIGIGTEAD
TFEEGEDLFAKIERRLAESEVACIFIDEAQFLSKDQVWQLARVVDDLRVPIMCYGLRVDF
QGNLFPGSAALLALADEMREVRTICHCGKKATMVVRMSESGMVLTEGAQVEIGGNERYVS
LCRKHWREAMGDV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctactttcaatattcgacgatgaacgcgggcaaatcgaccctgctgctt
caggcctcctacaactatcgcgaacgcgggatggatacctatctcatcaccgcgaaattc
gacaaacgcgcgggcgaaggccggatcggcagccgcatcggcatcggcaccgaggccgac
acgttcgaggagggggaggatctgttcgccaaaatcgaacgtaggttggctgagagtgag
gtggcctgcatcttcatcgacgaagcgcagttcctctcgaaagatcaggtctggcaactg
gcccgcgtggtggacgatctgcgcgtgccgatcatgtgttacgggctgcgcgtcgatttt
cagggcaatctgtttcccggctcggcagcccttctggcactggccgatgaaatgcgcgag
gtgcgcacgatctgtcattgcggcaagaaagcgacgatggtggtgcgcatgtcggaaagc
gggatggttttgaccgagggcgcgcaggtcgagatcggcggcaacgaacgctatgtctcg
ctctgtcgcaaacactggcgcgaggccatgggcgacgtctga

DBGET integrated database retrieval system