KEGG   Corynebacterium epidermidicanis: CEPID_07285Help
Entry
CEPID_07285       CDS       T03955                                 

Gene name
ppgK
Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cei  Corynebacterium epidermidicanis
Pathway
cei00010  Glycolysis / Gluconeogenesis
cei00520  Amino sugar and nucleotide sugar metabolism
cei01100  Metabolic pathways
cei01110  Biosynthesis of secondary metabolites
cei01120  Microbial metabolism in diverse environments
cei01130  Biosynthesis of antibiotics
cei01200  Carbon metabolism
Module
cei_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEPID_07285 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CEPID_07285 (ppgK)
Enzymes [BR:cei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CEPID_07285 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AKK03308
UniProt: A0A0G3GUU8
LinkDB All DBs
Position
1503936..1504697
Genome map
AA seq 253 aa AA seqDB search
MSSMTSLGFGIDIGGSGIKGAVVDLDTGELATERIRIPTPQPATPDAVAATVAQLVSLAE
WEGPVGITLPSVVLAQRALTAANIDPAWVDLDVHELFSSALPARDLTVLNDADAAGLAEA
TFGVTEARSGACILLTFGTGIGSAFLLEGELFPNTEIGHLLVDGKEAEHRASAAIKDNKG
LSYAQWAKRVDKVLHEYERLFRPTAFIVGGGISRKHEKWVPLLTVSTPVIPAQLRNNAGI
VGAAMAVAKQLRP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcatgacttcacttggcttcggcatcgacatcggcggatccggcatcaagggt
gcggtagttgacctggacaccggcgagttggcaactgagcggatcaggataccgactccc
caacccgctaccccagacgctgtggcggccaccgttgcgcaacttgtctcgcttgccgaa
tgggaaggaccagtgggcatcaccctgccctccgtcgtgctcgctcaacgggccctcacc
gctgcgaatattgatccagcctgggtcgatcttgatgttcatgaactgtttagttcggca
ctgcccgcacgggacctcaccgttctaaacgatgccgacgccgccggcttagcggaggca
actttcggagtcaccgaagctcgcagtggtgcctgtatcctactgaccttcggtaccgga
atcggctcggcttttctgctggagggcgagctcttccccaacaccgaaattggtcatctc
ttggtggatggcaaagaggcagaacaccgtgccagcgccgcgatcaaggacaacaagggc
ctgagctacgcgcagtgggctaagcgggtggacaaggtcctccacgagtacgaacgcctt
ttccggccaactgcattcattgtgggtggcggcatttcccgaaagcacgagaaatgggtt
ccgttactcacggtctctaccccagttatcccagctcaactgcgcaacaatgccgggatc
gtcggggcggcgatggcagtggcaaaacagcttcgcccttaa

DBGET integrated database retrieval system