KEGG   Corynebacterium epidermidicanis: CEPID_08440Help
Entry
CEPID_08440       CDS       T03955                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cei  Corynebacterium epidermidicanis
Brite
KEGG Orthology (KO) [BR:cei00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cei01001]
    CEPID_08440
Enzymes [BR:cei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CEPID_08440
Protein kinases [BR:cei01001]
 Serine/threonine kinases: Other
  Bacterial family
   CEPID_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo Pkinase_fungal Kinase-like Haspin_kinase RIO1 DUF4262 FTA2
Motif
Other DBs
NCBI-ProteinID: AKK03538
UniProt: A0A0G3GVG2
LinkDB All DBs
Position
1756021..1758252
Genome map
AA seq 743 aa AA seqDB search
MSSVQVGDILDNRYRIDTPIARGGMSTVYRCVDLRLGRQVAAKVMDDRYLDDPIFRTRFE
REARSMAQLNHPNLVNVYDFSSSSSHAFLIMELITGGTLRELLAERGPMPPHAATQVLRE
ILTGLAAAHRLGIVHRDIKPDNVLISSSHQVKLADFGLVRAITESERTSDHIIGTVSYLS
PEQVDGGHISAATDVYSAGIVLFELLTGMLPFSGDTQLGHAMARLSRDVPPPSSRIDGVP
PLFDELVAAATHRDPADRFATAMDFLAALEDVAAAEHLPAFTVPVPRNSAAARATAIVSL
PPLNDAARTDLIDTTDSTKVIPSHPVQPSGPPARGVADQTAQFPAAPSPSTAEESFQQLH
TRVESAISPEPGTPAVSRSFAPEPPPKPISNRSSIKIIVWLIVVGMLLASVAVGGWWFGS
GRYGEIPQVLGLDEHAATATVEQAGFVSSIRPTYSDDMPAGSVIGTDPPFGQRAPRSQQV
VVLLSQGRPTVPVLPTNGDVQRFRELLQERGLHLSFGEATFSDDVPVGGVVSTSPPVGSF
VTVGATVTASLSKGPAPVEVPVVAGLTEQQARQLLEKAGLRVSGVDRVFQERSAAGTVID
STPANHTKVARGTDVELKVSNALTVPDVSGLDRTAAKRVLEEAGFVVAIQESSEAREKKN
LVVKQAPEPGALVNPDHAQATIHLNSKVKVANVLGKSIPDATRILEEQGLAVSVLRDGDR
VIRQTPRSKSEVSADQVIELSAL
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtgcaggtaggcgacattctggacaaccgctatcggatcgacaccccgatc
gcccgcggtggcatgtccacggtctatcgctgtgtagacctgcggctcggccgccaagtg
gcagccaaagtcatggatgatcgctacctcgacgacccaattttccgcactcgattcgaa
cgcgaagcccgttcgatggcgcagctcaaccatcccaacctcgtcaacgtctacgacttt
tcctcctcatccagccatgcttttttgatcatggagctcatcaccggagggactctccgc
gaactgctagctgaacgtggcccgatgccaccgcacgcagcaacacaggttttgcgagag
atcctgactgggctcgccgccgcccacagactggggatcgtacaccgcgacatcaagccc
gacaacgtcttaattagctctagccaccaggtaaaactcgcggattttgggctggttcgt
gcaattactgaatcggaacgcaccagcgaccacatcatcggcacggtgtcttacctttcc
cccgagcaagtcgacggcggacacatcagcgctgctaccgatgtctactcggccggcatc
gtccttttcgaactcctcaccggtatgctccccttctctggtgacacgcaactcggccac
gcgatggcacgactgagtcgcgatgtccctcccccgagcagcaggatcgacggcgtgccc
ccgcttttcgacgaactagtggccgccgccacccaccgagatccagcagatcgtttcgct
accgctatggacttccttgcggcactagaagacgtcgctgcagcggaacatcttcccgca
ttcacggtgcccgtaccgcgcaactccgccgctgcccgcgccaccgcaattgtgtcgctg
ccacccctcaatgacgccgcgcgcactgatctcatcgacaccactgattcgaccaaagtt
atccctagtcatcctgttcagccatcaggtccgcccgcacgcggcgttgctgatcagacc
gcccagtttcctgccgcgccgtcgccttcgacagctgaagaatcatttcaacagctccac
acgcgggtggagtcggcgatttcgccggaaccaggcactccagcggtttcgcgttctttc
gccccagaacctccgccgaagcccattagtaatcggtcttccatcaagatcattgtctgg
ctgatcgtcgtcggcatgctgttggcctccgtcgctgtagggggctggtggtttggctct
gggcgatatggggaaataccccaggtgctcggacttgatgaacacgcagcaacggccacc
gtggaacaggcgggatttgttagtagtatccgccccacgtactcagatgacatgcctgct
gggagtgtgatcggcaccgatcccccttttgggcaacgagcaccacgtagccaacaggtc
gtggtgctcctatctcaaggccgtcccacggtccccgtccttcccacaaacggagatgtg
cagcgatttcgagagctcctccaggaacgcggactccacctcagctttggcgaagccacc
ttttccgacgatgttccggttggcggcgtggtatcaacctcacctcctgttggctcgttc
gtcacggtaggcgccacagtgacagcgtcgctgagcaaaggccctgccccagtcgaagtc
ccagtcgtggcaggcctcaccgaacagcaagcacgacagttgctagaaaaggctggtttg
cgagtatccggcgttgaccgagtattccaagagcgctccgcagcaggcaccgtcatcgat
tccaccccggcgaaccacaccaaggtggcacgaggcacagacgtagagctgaaggtgtcc
aacgctctcaccgtgccggacgtgagcggactcgaccgaactgcggccaagcgcgtcttg
gaagaagccgggttcgtcgttgcaattcaggaatcatcagaagctagggagaagaagaac
ctcgtggtcaaacaagccccggagccgggagcgctcgtcaacccagaccatgctcaggcg
acaattcacctcaatagtaaggttaaggtggcaaatgtactcggcaagtcaattcctgat
gccacgagaatcctagaggaacaaggcctagcggtttctgtgctacgagacggtgaccga
gttattcgccaaactccacgtagcaaatcggaagtatcggcggatcaggtcattgagctc
agcgcactctag

DBGET integrated database retrieval system