KEGG   Cellvibrio sp. KY-YJ-3: D0B88_06255Help
Entry
D0B88_06255       CDS       T06234                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cek  Cellvibrio sp. KY-YJ-3
Brite
KEGG Orthology (KO) [BR:cek00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0B88_06255
Enzymes [BR:cek01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0B88_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_3 FAD_binding_2 Glutaredoxin AlaDh_PNT_C FAD_oxidored DAO NAD_binding_8 Thi4 NAD_binding_7 K_oxygenase Thioredoxin_9 FMO-like Chalcone_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QEY11911
UniProt: A0A5J6NUW4
LinkDB All DBs
Position
1479076..1480641
Genome map
AA seq 521 aa AA seqDB search
MLDAAIKGQLTAYLEKLQAPIELIASLDSSAKSTEMLSLLEEITTLSNKVSLRQNGNATL
TPSFYIGAVGSSARIQFAGIPMGHEFTSLVLALLHSGGHPPKVDAKTIEQIKVIDTPLHF
EVFVSLSCHNCPDVVQAVNLMAALNPKITATMIDGALFQQEVDARKIMAVPTVFVNGDHF
GQGRMTLEEIIAKVDTGAAERDAKALSERAPYDVLVIGGGPAGAAAAIYSARKGIRTGVV
AERFGGQVLDTVSIENFISVKETEGPKLAMALEQHVKEYDVDVMNLQKAAQVIPGDNPGD
LIEVKLASGASLKSKSIILATGARWREMNVSGEQEYRGKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSKLRADAVLQRKLFSLPNVTVITEAMTTEVIGNG
EKVTGLKYKSRNTDEIATVELEGIFVQIGLLPNTDFLKGTVQLTNRGEIDINARGETSVP
GVFAAGDCTNVPYKQIIIAMGAGATASLGAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgccgcgatcaaaggccaactcactgcctaccttgaaaaactgcaagcgcct
atcgaactgatagcgagcttggactccagtgccaaaagcaccgaaatgttaagcctgttg
gaagagattacgacgctctccaataaagtcagcctgcgtcaaaatggcaacgcaacatta
acgccttcattttatattggcgctgtgggttccagtgcgcgcattcaatttgcgggcatt
ccgatgggccatgaatttacttctttagtgttggcattgctgcacagcggtggtcatccg
cccaaagtggatgcaaaaaccatcgaacaaattaaagtgatagatacaccattgcatttt
gaagtgtttgtatcgctctcttgtcacaactgtccagatgtggtgcaggccgtaaattta
atggccgcgttaaatcccaaaattactgccaccatgatcgacggtgcattgtttcaacaa
gaagttgatgcacgcaaaatcatggcggtgcccacggtatttgttaacggcgaccacttc
ggtcaaggccgtatgacgctggaagaaattatcgccaaagtggataccggtgcggctgag
cgcgatgcaaaagcgctgagcgaacgcgcgccttatgatgtattggttatcggcggtggc
ccagccggtgcagcggcggcaatttattccgcgcgcaaaggtattcgcaccggtgtggtt
gccgagcgttttggcggtcaggtactggatactgtatcgatagaaaactttatttcggtg
aaagaaaccgaaggcccgaaattggcgatggccttggaacaacatgtgaaagaatacgac
gtggatgtaatgaatttacaaaaagcggcgcaggttattcctggtgataatcccggtgat
ttgattgaagtaaaactcgccagcggtgcgagtttaaaaagcaaaagtattattctcgcc
accggtgcacgctggcgtgaaatgaatgtatcgggcgagcaggaatatcgcggtaaaggc
gttgcctactgcccacattgcgacggcccattatttaaaggtaaacgcgtcgcggtaatc
ggtggcggcaactccggtgtggaagcggcaattgatttggccggtatagtcgcccatgtc
accctgatcgaattcgattcaaaattgcgcgccgacgcggtattgcaacgtaaattattc
agcttgcccaacgtgacggtgatcactgaggctatgaccaccgaagtgatcggcaacggc
gaaaaagttaccgggcttaaatacaaaagccgcaataccgatgaaatcgctaccgtagag
ttggagggtatttttgtccaaatcggtttgctgcccaataccgatttcttaaaaggcact
gtgcagctgaccaatcgcggtgaaattgacattaatgcgcgcggtgaaacttcagtgccc
ggtgtatttgctgccggtgattgcaccaacgtgccctacaagcagattattattgccatg
ggcgcaggcgctaccgcatcgctcggtgcgtttgatcatttgattcgcacaagcgcgccg
gcgtaa

DBGET integrated database retrieval system