KEGG   Caenorhabditis elegans (nematode): CELE_B0218.3
Entry
CELE_B0218.3      CDS       T00019                                 

Gene name
pmk-1
Definition
(RefSeq) Mitogen-activated protein kinase pmk-1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04212  Longevity regulating pathway - worm
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_B0218.3 (pmk-1)
   04068 FoxO signaling pathway
    CELE_B0218.3 (pmk-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0218.3 (pmk-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_B0218.3 (pmk-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_B0218.3 (pmk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_B0218.3 (pmk-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_B0218.3 (pmk-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like NAD_Gly3P_dh_N NAD_binding_8
Other DBs
NCBI-GeneID: 191743
NCBI-ProteinID: NP_501365
WormBase: WBGene00004055
Ensembl: WBGene00004055
UniProt: Q17446
LinkDB
Position
IV:join(8148806..8148954,8148999..8149564,8149932..8150296,8150688..8150741)
AA seq 377 aa
MFPQTTMDHILHPTPREGYYVVELNRSVWVVPNYYINLTPIGTGAYGTVCAAECTRSGTR
VAIKKFNRPFQSIIHARRTYRELRLLRCMCHENIIDLLDVFTPNENVNDIEDVYFVSMLM
GADLSNILKIQRLNDDHIQFLVYQILRGLKYIHSADIIHRDLKPSNIAVNEDCELKILDF
GLARQTDSEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAELITGKTLFPGSDHI
DQLTRIMSVTGTPDEEFLKKISSEEARNYIRNLPKMTRRDFKRLFAQATPQAIDLLEKML
HLDPDRRPTAKEAMEHEYLAAYHDETDEPIAEEMDLNDDVRADTIDEWKKIIWEEISDFQ
KNVAFADEEEDEEKMES
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtttccacagacaacaatggatcatatacttcatccgactccacgagaaggatactat
gtcgttgagcttaatcgaagtgtctgggttgttccaaattattatattaacttgactcca
attggtaccggagcatatggaactgtttgtgctgctgaatgtactcgctcggggactcgc
gtcgcaatcaaaaaattcaatcgtccatttcaatcaataattcatgcccgtcgtacatat
cgtgaactccgacttcttcgttgtatgtgtcatgaaaatataattgatctacttgatgtc
ttcactccaaatgagaatgtaaatgatatcgaggatgtgtattttgtatcaatgttgatg
ggagctgatctatcaaatattctcaaaattcagcgactcaacgatgaccacattcaattc
ttagtctatcaaattcttcgtggactcaaatacattcattctgcagatattattcatcga
gatcttaaaccatcaaatattgctgttaatgaggattgtgaattgaaaattcttgatttt
ggattggcacgtcaaactgattctgaaatgactggatacgtggcaacaagatggtacaga
gctccagagattatgctcaattggatgcattacacgcagactgttgatgtatggtcagtt
gggtgtattcttgcagaacttatcactggaaaaacattgttccctggatctgatcacatc
gatcaattgactcgtatcatgtcagtaactggaacaccagatgaagaattccttaaaaag
atctcatcagaagaagctcgtaattacattcgaaatcttccaaaaatgactcgccgtgat
ttcaaacgtctgtttgctcaagcaactcctcaagcaatcgatctccttgaaaagatgctt
caccttgatccagatcgtcgtccaactgcaaaagaagctatggagcatgaatatctggct
gcttatcacgatgaaactgatgagccaattgcagaagaaatggatttgaatgatgatgta
agggcagatacaattgatgaatggaagaaaattatttgggaagagatcagtgatttccag
aaaaacgtggcatttgctgacgaagaggaagatgaggagaaaatggaatcgtag

KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.3
Entry
CELE_F42G8.3      CDS       T00019                                 

Gene name
pmk-2
Definition
(RefSeq) Mitogen-activated protein kinase pmk-2
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04212  Longevity regulating pathway - worm
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G8.3 (pmk-2)
   04068 FoxO signaling pathway
    CELE_F42G8.3 (pmk-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F42G8.3 (pmk-2)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F42G8.3 (pmk-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F42G8.3 (pmk-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F42G8.3 (pmk-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_F42G8.3 (pmk-2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH FTA2 CLTH
Other DBs
NCBI-GeneID: 177611
NCBI-ProteinID: NP_741457
WormBase: WBGene00004056
LinkDB
Position
IV:join(8143511..8143615,8144213..8144298,8144348..8144536,8145042..8145153,8147053..8147130,8147182..8147296,8147625..8147696,8147746..8147842,8147927..8148131,8148182..8148331)
AA seq 402 aa
MGMSATMGDSASIPGVFFADFGPAPPEITPEGYHEVELNKTKWVLPQWYNSLKPLGEGAY
GVVCTAEYEPTGDRVAIKKFFRPFQSTIHAKRTYRELKLLRTLQHDNVLEMIDVFTPDPD
ASSLNNVYFVSVLMGSDLQNIMKIQRLTDEQIQLLIYQVLRGLKYIHSAGIIHRDLKPSN
IAVNERCEVKILDFGLARAQDAEMTGYVATRWYRAPEIMLNWMHYTQTVDVWSVGCILAE
LVSGRPLFPGDDHIDQLTKIMSVVGTPKEEFWSKIQSEEARNYIKNRSPIIRQDFVTLFP
MASPYALELLEMMLILDPDRRISVSSALRHDYLREYSVPNDEPVAMDTVINSIVTIDPAE
ERATTLSDWRELIWNEIRLFQNSARRLSFVSCTDTEEEPMKI
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggggatgtcggcgaccatgggcgattcagccagcattcccggtgtcttttttgccgat
tttggtcctgccccgcctgagattactccagaaggatatcatgaggtcgaactaaacaaa
acgaaatgggtcttacctcaatggtacaacagtttgaagcctctaggagaaggagcgtat
ggagttgtatgcacagcagaatatgagccaactggagatcgagttgcaattaaaaagttc
tttcgcccatttcaaagtacaattcacgcaaaacgaacctatcgggaactgaaacttcta
agaactctacaacatgataatgtattggaaatgattgatgtattcacaccagatccagat
gcatcttctttgaataatgtatatttcgtatccgttctgatgggctccgatttacaaaat
attatgaaaatccaacgactgaccgatgaacaaatccaactgcttatctatcaagtgtta
cgtgggctcaagtatatccattcggcagggattatccatcgcgatttaaaaccatcgaat
attgctgtcaatgagagatgcgaagtcaagattctcgattttggattggctcgtgctcaa
gacgccgaaatgactggatacgtggcaacaagatggtacagagctccagagattatgctc
aattggatgcattatacacagactgttgatgtttggtcagttggatgtattcttgcggaa
ctggtatccgggagaccattgtttccaggcgatgatcatattgatcagctaacaaagata
atgtcagttgtgggtaccccaaaagaagaattctggtccaaaattcaatcagaagaagct
cgaaattatattaaaaatcgttctccaattatccgtcaggacttcgttacattgtttcca
atggcttctccatatgctctcgaacttctcgaaatgatgctaattttggatccggacaga
agaatttctgtatcaagtgctcttcgtcatgactatcttcgtgaatactctgtgccaaat
gatgaaccagttgcaatggatacggtaataaatagcatagtcacaattgatccagctgaa
gaacgagcaacaacgttatccgactggcgagagttaatttggaatgagattcgattattc
caaaactcggcacgaagactaagttttgtaagctgtacggatacggaagaagagccaatg
aaaatatga

KEGG   Caenorhabditis elegans (nematode): CELE_F42G8.4
Entry
CELE_F42G8.4      CDS       T00019                                 

Gene name
pmk-3
Definition
(RefSeq) Mitogen-activated protein kinase pmk-3
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04068  FoxO signaling pathway
cel04212  Longevity regulating pathway - worm
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F42G8.4 (pmk-3)
   04068 FoxO signaling pathway
    CELE_F42G8.4 (pmk-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F42G8.4 (pmk-3)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_F42G8.4 (pmk-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_F42G8.4 (pmk-3)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_F42G8.4 (pmk-3)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_F42G8.4 (pmk-3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo Pkinase_fungal RIO1 Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 177610
NCBI-ProteinID: NP_001370308
WormBase: WBGene00004057
Ensembl: WBGene00004057
LinkDB
Position
IV:join(8140246..8140497,8140981..8141126,8141177..8141261,8141560..8141669,8141715..8141862,8142036..8142642,8142724..8142800)
AA seq 474 aa
MASVPSSSSLPVSHVRRHEDVSTPSAPPTKRSNNQSQPPESYEPNTWLQQQREQEQQKKL
AAENIKKQSIEATGNNEMVGEEEEDILSKPCGPHKRRFQFVMIRNITFAIPEGYDVEPNS
IEYLGGGSFGNVIKTSAVCRDGLRRYVAIKKMREPFFDPHHARRIFRETKLLQLMRHDNI
ICALDIYTPDEENDFRDVYVVTEFAGRSLYQILKQQRDYGRRVLTDEHIKFIIYQIIRAL
KYIHSANIIHRDLKPGNLALTDDSDLMILDFGLARSLEKKDTSLTQYVQTRWYRSPEVIY
WKIDSYTNLADMWSLGCIAAELLTGEPLFPGDEPNAQYQRITQLCGSPDEELLTKIENDN
SSAIKAVIQSYTTHKRRNFRDVFSAHNPSEDFIDLLEKLLVLDPEKRITVEEAIQHPYLA
EFSLPEDEPRADHIFDLDDSQARTRFEWRDAVWKEIMNYKRLSSSPLIPGEADR
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggcgtcagtcccatcgtcatctagtctcccagtgtcgcatgtccgtcgtcatgaagac
gtgtcaacaccaagtgcaccaccaaccaaacgaagtaataatcaatctcaacctccagaa
agctacgaacccaacacctggttgcaacaacaacgagagcaggaacaacagaaaaagtta
gctgcagagaatattaagaagcagagtatcgaagcaacgggaaacaacgagatggttggg
gaggaggaagaggatattctctcaaaaccatgtggtccacacaaacgacgattccaattt
gtgatgatccgtaacattacatttgcaattccggaaggctatgacgtcgagccaaacagc
attgagtatttgggtggaggctcgtttggaaatgttataaaaacaagtgcagtgtgccgt
gacgggcttcgtcgttatgttgcaataaagaagatgcgagaaccgttctttgatccacat
catgctcgtcgcatcttccgtgaaacaaaacttcttcaattaatgagacatgacaatatc
atctgtgctcttgacatctacacacctgacgaggaaaacgattttcgagatgtatacgtt
gtcactgaatttgcgggtcgtagtctttatcagatcttgaagcaacaaagagattatgga
cggcgcgtgctgaccgacgagcatatcaaattcatcatttatcaaatcatacgtgcactt
aagtacattcattctgctaatattatacatcgtgacttgaaaccaggaaatctcgcgttg
accgatgattctgacctcatgattctcgattttggacttgcaagatccttggaaaagaaa
gatacttctctaacacaatatgtacaaacaagatggtaccgtagtccagaagtcatttat
tggaagattgatagttacacaaatctggcagatatgtggtcacttggatgtattgctgca
gaacttttaactggagaaccactgtttccgggtgatgagcccaatgctcaatatcaacgt
attactcaattatgtggaagtcctgatgaagaacttttgacaaagattgaaaatgataac
tcgtctgcaattaaagccgtaattcaatcctacacaactcacaaacgtcgaaatttccgt
gatgtattttctgctcataatccatcagaagactttattgatctacttgagaagctttta
gttttggatccagagaagaggattacggtggaagaagctattcaacatccatatttggca
gagttttcacttccagaagatgaaccaagagctgatcatatatttgacttggatgactct
caagctagaacaagattcgagtggagagatgccgtctggaaggaaataatgaactacaaa
agactcagctcatcaccgttaatccctggagaagcagatcgctga

DBGET integrated database retrieval system