KEGG   Caenorhabditis elegans (nematode): CELE_B0261.2
Entry
CELE_B0261.2      CDS       T00019                                 

Gene name
let-363
Definition
(RefSeq) Target of rapamycin homolog
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04012  ErbB signaling pathway
cel04136  Autophagy - other
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_B0261.2 (let-363)
   04150 mTOR signaling pathway
    CELE_B0261.2 (let-363)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_B0261.2 (let-363)
   04136 Autophagy - other
    CELE_B0261.2 (let-363)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0261.2 (let-363)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_B0261.2 (let-363)
   04213 Longevity regulating pathway - multiple species
    CELE_B0261.2 (let-363)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_B0261.2 (let-363)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_B0261.2 (let-363)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CELE_B0261.2 (let-363)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   CELE_B0261.2 (let-363)
Membrane trafficking [BR:cel04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    CELE_B0261.2 (let-363)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT DUF3385 FRB_dom FATC HEAT_2 HEAT Sec7_N Tti2 Ints3
Other DBs
NCBI-GeneID: 172167
NCBI-ProteinID: NP_491549
WormBase: WBGene00002583
Ensembl: WBGene00002583
LinkDB
Position
I:join(5245781..5245903,5245959..5246059,5246113..5246407,5246452..5246781,5246831..5247042,5247087..5247147,5247198..5247370,5247510..5247623,5247670..5247967,5248575..5248688,5248738..5248915,5249352..5249722,5250855..5250998,5251050..5251664,5252148..5252315,5252364..5252949,5253195..5253379,5253427..5253824,5254163..5254578,5255141..5255231,5255278..5255434,5257088..5257588,5258355..5258560,5258608..5258750,5259296..5259858,5260284..5260379,5260436..5260636,5260686..5260850,5261082..5261617,5262189..5262327,5262382..5262649,5262851..5262990)
AA seq 2695 aa
MLQQHGISFQMNADRQNKAATTSNRIVSAPATNEFDERHRKQGIDAARALASQYRSRITE
NRDANQRQAARELSRYVRSELKDEPNTFSDAFLNAIDGRTDIASQSAIYNCMKSNSNIDQ
KRAGIYLIVCLAETHSGNVIRYANYLLKMLNNGNGLDEDTVKMASKALAFLIATCKSYAA
ELVDRCLDHCHEWLGQNVPHSQQPKNQQEIDQIRRLAASHLSRELALATPTAFFLRVNLF
FKYIFNAVRDKNPAVRIAGIDALHVVLTIVSQREAKNKTEWFKKCFDEALEGQPNPSQKD
DLDRWHAVALILNELLRISDQRFELIRCESSQFIKQKFLKEDEEEGVEWLVLTKQQTIVE
SVTARKLVLERFPKILDCVRQIIPLANKTSSTKQQSSIYLNTVLMQLLPRICAFPQCDRT
FQTISFDTSFTILQRNAVAAPAIGMMMLSNPDVHATHIEKTISFISAAIKKTTNSDVLDN
YFTFLFLFVDAYHEQVTTQIKAIIPQLMDITLSRSLANVLKMIMMRIPKLRLNVQDGVMA
SVYQTLTGSLIPPKSEPIGRPASPKAILQKAETDPKELQRIVLAVDVLGEFYFSRGALQR
IMQYVADYYLTADNVEIRLAAVSSCCEMVVPFVGVYKKVTSDKRNSLLQTIYGVLRAVCS
VIVNDQDVRVRMQVISCFGQMPRPFLAHLAQPEMLEVQFMALHDEKLEMQQACVTLLGRL
AELNPALVLPRLRLMLLETLSQMQQSGQARLEQHSAKMIAQLAKQSPKFMRPYVGSLMIA
MIPKLRNDQKYAEVTAQVLNAVSEIAVIGGAEIVKNLKPLFEKLTHMINDSSSLHKREAA
LRAIGGICRSTAYVVDPYRDYPSLLDDLLRILKTVMSNTMRREAIKTLGILGAIDPYTHK
VFTGSVQSSTAISTALSLPISETDSKDPRQDIIHWFNYEKCTLEEFYPAITIANLMLMMQ
DEDSQSYAEIAQAIVTIFRSLGDMAPLYTEQVIPRLIEVCRRATESSNRANLREFFLQQL
ANFVAIIRKHAAPYMPAIFTIIADAWKEDISVKMVVIEVLTDMGTAIGNDFSKYTGELIP
YLLTVLQTDKTKERVLTVKVMESIQKLTHCIVQHLHLVLPPLLIILDDFSLKLSIRNTAL
STVLHMTQQVDVSAYAPRMMQSWHHNISTAEMRDKLLLLLIEIIKQLGKFFDIFKRGVDQ
KLRDYNLDKSVHYEQYRKLAQRAQMSRDVLTSSVFAGSNGNIQYSSTQAGMRGQANNVYA
NNDLHERLMNGSIDSGASRQDNRDDYYRYGVEEKISEEVPKVAPTTARPTSELVTVQITK
QRLNKDALMPQWKNENLTSKDEWLQWLMKIRIGFLTYGSSPSLRAASSLGDQHPHLARDL
FPAAFMSVWTELDSDVQNDLTSCLLRAISTGIPELIQTILNLAEFMDHSEKGPLPISHDV
LGRWAEQTKAFAKACRYKEMSVLKKSGSMQTTFTRKVKLEPNDCQSLITYANKLNVQEEA
AGVVRYAERNEMNFQMRGRWYEKLNEWEKALGAYELEEKKKSSCPNLQVYDEKDHLMTPE
EAATAEEARMHEMRCLEALGRWDELNSKSVVWADQRGNRNDSVRDEINKKQLDHKMAVIA
ARGAWAVDNWERMADYVSVISENTQDGAMLRAVVAVHNDENTKAMGLIEKVREMIDSELT
AMANESYERAYIPMVSVQQMAELEEAIEYKTRPERRPRIALLWSRRLQGCRRNVEQWQRL
IMLRGLVLSPQEMHPLRVKFSSMCRKQGKNSMSRAVLRELLSLPANSDLVRAKAPFDKPL
LVLALAKQLYQDDHKDEAIRALEDLANHWNKRINPIPKATGRELIPPSTKEPARICAKVL
LKLGEWTELKSKTSNNMQVGELSFVRQQVSPQYRTKESRTPETIAFENTINYYQQATQYD
PGWHKVWHKLASTHFYAVCRERPHPTTVISPPQQPQQPKKMHIPPVTRATSPPPPAQKSP
QPAPFHSITEPLSVIIDYPVPPPLGSLVGLPPMPAYLSSNSSLPPQHHHVSPLSNDSPSN
SAENKLYLKHAAHAVRCFAKALMCSPGSRLEDTLRLMQLWFDHGDDKDQDVYFALTETIF
DLPVTTWLEAIPQLMARLDCPDDQKSVQLVLRVLCEIARHRPQAVIYALTVASRSKDVHR
SKNAGTVLEKMMEYHSKLVREASLVTEELVRCAILWHEQWHDALDDASRVYFHDNNVQAM
FDALRNMNDLMQKGAPTTMKEHSFQQTYSSDLKEAGRYVQAFESSGNVKDLNQAWEIYCS
VFKKLRDQLATLNSLDLVYVSPNLVSAKDLELVVPGTYDPSAPIVSIQSFSSKMNVITSK
QRPRKMVIRGSNGLDYQFLLKGHEDPRQDERVMQLFGLVNTLLANNSETCRRNLTIQRYS
IVALSKDSGLIGWVPNCDTLHTLVKEYREKKAKIPLSIEHKTLQKLSLETEHLTLMQKLQ
LFESALSVTQGEDLRHVLWLKSPSSEVWFDRRTNYTRSVACMSMVGYILGLGDRHPSNLM
LDRLTGKVVHIDFGDCFEVAMLREKFPERVPFRLTRMLINAMEVTGLDGVYNYTAERVLK
MLRTNQESLLAVLEAFVYDPVINWRLVEGMKKDPKTRKDTGGRQNMAGAVLPSSSTTDSI
METIKRKLDGTEFVHTDGSTPPEPLQVTEQLAMLTEQATSPLNLCQSYIGWCPFW
NT seq 8088 nt   +upstreamnt  +downstreamnt
atgctccaacaacacggaattagttttcaaatgaatgccgatagacagaacaaagcagcc
acaacttccaatcgaatagtctccgctccagctacaaatgaatttgacgagcggcatcgt
aaacaagggattgatgctgcaagagctcttgcttcacaatatcggagccgaattacggaa
aatagagatgcaaatcaacgacaggctgctcgagaactcagcagatatgttcgaagtgag
ctgaaagacgagccaaatacttttagtgatgctttcctgaatgcaatcgatggacgaaca
gatatagcctctcagagtgcaatttataattgtatgaagtcgaattcaaatatcgatcag
aaacgagccggtatctatctcatcgtgtgcttagctgaaactcattctggaaatgttatt
cgatatgcgaattatcttctgaaaatgttaaataatggaaatggattagatgaagataca
gtcaagatggcttcaaaagctctcgcttttctgattgcgacttgtaaatcatacgcggcc
gagctggttgatcgttgtcttgatcattgccacgaatggcttggtcaaaatgttccacat
agtcagcaacccaaaaatcaacaggaaattgatcaaattcgtcgactcgccgcttcacac
ctctctcgtgagctcgcactggccacaccgacagcattctttcttcgtgtaaacttattt
ttcaagtatatcttcaacgctgtcagagacaagaatccagctgtaagaatcgccggaatt
gatgcattacacgtggttttgacaattgtttcacagcgtgaagcaaagaataaaactgag
tggtttaagaaatgtttcgatgaagcactggaaggtcaaccaaacccatcgcaaaaggac
gatttggatagatggcatgccgtcgccctgattctcaatgaacttcttcgaatttctgat
caacgattcgaactcatcagatgtgaatcctcacagtttattaaacaaaagtttttgaaa
gaagacgaagaagaaggtgttgaatggcttgtcctaactaagcaacaaactattgtggaa
agtgtgactgctcgaaagctggttttggaacgatttccgaagatactcgattgtgttcgt
cagataatacctctcgcaaacaaaacttcatccacgaaacagcaaagctcgatttacctg
aatacagttctcatgcagcttctaccaagaatttgtgcatttccacaatgtgatcgaact
tttcaaacaatctcattcgacacttcatttactattcttcaaagaaatgcggtcgctgct
ccagcaatcggaatgatgatgctctcgaatccagatgtacatgccacacatatcgagaaa
acaatcagttttatctctgctgctatcaaaaaaacgacgaattctgatgttctcgataat
tatttcacattcctgttcctatttgtggatgcttatcacgaacaagtgacgacacaaatc
aaggcaataattccacaattaatggatattaccctgtctcgatcgctggcaaacgtgcta
aaaatgattatgatgagaattccgaaactgcggctgaatgttcaagatggtgttatggct
tctgtctatcaaacactcactggatctctaattccaccaaaatccgaaccgattggaagg
cctgcgagtcctaaagctattttgcagaaagcagaaaccgatccaaaagagcttcaacga
atcgtgctggctgtcgatgtgctcggtgaattctatttctcaagaggtgccttgcagaga
atcatgcaatacgttgcagattactacttgacagcggacaatgtggaaatccgtttggct
gctgtctcttcgtgttgtgaaatggtcgtaccatttgttggagtttataaaaaagttaca
agtgacaagagaaatagtcttcttcaaactatttatggtgtgctgcgagctgtttgttcg
gttattgttaatgatcaagatgtccgtgtcagaatgcaagtaatcagctgtttcggacaa
atgccacggccattccttgctcatttggctcaacccgaaatgctcgaagtacaatttatg
gctcttcacgacgaaaaactcgaaatgcagcaagcatgtgtgacgttactcggacgactc
gcagagctcaatccggcacttgttttgccacgtcttcgattgatgctcctagagacattg
agtcaaatgcaacaaagtggtcaggcaagattggagcaacattctgcgaaaatgatcgcg
caattggcgaaacagagtccaaagttcatgagaccatacgttggaagtttaatgattgct
atgattccaaaattgagaaatgatcaaaaatatgccgaagtgactgcccaagttctgaat
gctgtcagcgaaatcgccgtgattggtggagccgaaatagtaaaaaatttgaagccattg
ttcgaaaagttgacacatatgataaatgattcgagcagcttgcataaacgagaggcggct
ctccgtgcaattggtggaatatgtcgttcaactgcatatgttgtggatccatatcgagac
tatccaagtctacttgatgatcttcttcgaatcctgaaaactgtcatgtcaaatacaatg
agacgagaagctatcaaaactctcggaattcttggagcaatcgatccatatactcataaa
gtattcactggctcagtacaaagctcgacagctataagcacagccttatcacttccaatc
tctgaaactgattcaaaagatccacgtcaagacattattcattggtttaactatgaaaaa
tgtacattagaagagttttatccagcgattacgattgcaaatttgatgttaatgatgcaa
gacgaagattcgcagagctacgcggaaattgctcaagctatagtaacaatcttcagaagt
cttggtgatatggcaccattgtatacagaacaagtcattccaaggctaatagaagtttgt
cggcgagcaactgaatcatcaaatcgagccaatttgagagagttctttcttcaacaattg
gcaaatttcgtggcaattataagaaagcacgcggcaccgtatatgccagctattttcacg
attatcgcggatgcttggaaagaggatatatccgtcaaaatggtggtcattgaagttctc
actgatatgggaactgccattggaaacgatttcagtaaatacacaggcgaactaataccg
tatctgttgactgtactacaaactgataagaccaaggaacgagttctcactgtgaaggta
atggaatcaattcaaaaactgactcattgtatagttcaacatcttcatcttgttcttccg
cctcttctcataattcttgatgatttctcgttgaagctatcaattcgaaacacggctctt
tctacagtacttcatatgactcaacaagttgatgtgtctgcatatgctccacgtatgatg
cagagttggcatcataatatttcaactgctgaaatgagagataaactgctccttttattg
attgaaatcatcaagcaactcggaaaattctttgatattttcaaacgaggcgttgatcag
aagctacgcgattataatcttgataaaagtgttcactatgagcagtatcggaagcttgct
caacgagcacaaatgtcacgtgatgtgcttacttcatcagtttttgcgggatccaatgga
aatatacagtactcttcgacgcaagcgggcatgcgaggtcaggctaacaatgtttatgca
aataatgatctacacgagagactgatgaatggatcaattgattcgggagcgagtcgacag
gacaatcgagatgattattatagatatggagtcgaggagaaaatttcagaagaagttcca
aaagttgctccaacaactgctcgccctaccagtgaactcgtgacggttcaaatcacaaaa
caacgtctcaataaggatgctttgatgccacaatggaaaaatgagaatttgacttcaaaa
gatgaatggttgcagtggttgatgaagattcgaataggatttttaacttatggaagttct
ccatcgttacgtgcagcttcttcacttggtgatcaacatcctcatcttgcacgtgatcta
tttccagctgctttcatgtctgtatggactgaacttgattcggatgtacaaaacgatcta
acttcatgtcttctccgagcaatctccacaggaattccagaattaattcaaacgattctg
aatcttgccgagtttatggatcattctgagaaaggaccacttccaatttctcatgatgtt
ctcggtcgatgggctgaacaaacgaaggcttttgccaaagcatgtagatataaggagatg
agtgtactgaagaagtcgggttcaatgcaaacgacgtttacgagaaaagtgaagctggag
ccaaatgattgtcagagccttatcacatatgccaataaattgaacgtacaagaggaagct
gcaggtgtcgtaagatatgctgaaagaaatgagatgaacttccaaatgcgcggtcgctgg
tacgaaaaactgaacgaatgggaaaaagcactcggagcatatgaacttgaggaaaagaaa
aaatcgtcatgccccaatctccaggtttatgatgaaaaagatcatttaatgacaccagaa
gaagcagcaacagcagaagaagctcgaatgcatgagatgagatgtttagaagcattggga
agatgggatgaattgaatagtaaatcagtagtttgggcggatcaacgaggaaataggaat
gattcggttcgtgatgagatcaataagaagcaattggatcataaaatggcagtgattgcg
gcaagaggagcatgggctgttgacaattgggaacgaatggctgattatgtttcagtgata
tctgaaaatacacaagacggtgcaatgcttcgagctgtggtagctgttcacaatgatgaa
aacacaaaagccatggggctaatcgaaaaagttcgcgaaatgattgacagtgagctgaca
gcaatggctaacgaaagttacgagagagcatatattccaatggtttctgttcaacaaatg
gctgaattggaagaagctattgaatataagacccgtcccgaacgtcgacctcgaatcgca
cttctgtggagtcgacgcctacaaggatgtcggcgaaatgtggagcaatggcagagactt
attatgctccgtggacttgtattatctccacaagagatgcatccactacgagtcaaattt
tcatcaatgtgtcggaaacagggaaagaattcaatgtctcgtgcagtacttcgagagctt
ctctctcttccagcaaattctgatttggtgcgcgcaaaagctccatttgacaagccgctg
ttggtgttggcgttggcaaaacagttgtatcaggatgatcacaaagatgaagcaattcga
gcacttgaagatttggcgaatcattggaataaaagaattaatccgattccaaaggcgact
ggtagagaactgattcctccgtcgactaaagaacccgcgagaatttgtgcaaaagttttg
ttgaaacttggagaatggactgagctgaaatcaaagacttcgaataatatgcaagtcgga
gaattatcatttgttcgtcaacaagtatcacctcaatatcgaacaaaagaatctcgtaca
cctgagacaattgcctttgagaataccataaattactatcaacaggcaacacaatacgat
cctggatggcataaagtttggcacaaattggcttctacacatttctatgctgtctgtcga
gaacgaccacatccaacaacggtcatttcaccgccgcagcagcctcaacaaccgaagaaa
atgcatattccaccagttacgagggcaacatctccacctccaccggctcaaaagtcgcct
cagcctgctccatttcatagtattacagagccactctctgtaattatagattaccctgtt
ccaccaccacttggttcactcgtcggtcttccaccaatgccagcttatttgtcttcgaat
tcatcacttccaccacaacatcatcatgtctcaccattgagcaacgattctccatcgaat
tcagctgaaaataagctttatttgaaacacgcggctcacgctgtgcgatgcttcgcaaag
gctctgatgtgctcaccgggttctcgacttgaagatactctccgattgatgcaattgtgg
tttgatcatggagatgataaagatcaagatgtttattttgctcttacggagacaatcttt
gatcttcctgtgacaacatggttagaagctattcctcaattgatggctcgtttggattgt
ccagatgatcagaaaagtgttcaacttgttcttcgagttctttgtgaaattgccaggcat
agaccacaagcagtaatctatgcactaactgttgcatcgagaagtaaggatgtacataga
agtaagaatgctggaacagttctcgaaaaaatgatggaatatcattcaaaattggttcga
gaggcaagtcttgtgacagaagagcttgttcgttgcgcaattctgtggcatgaacagtgg
catgatgcacttgatgatgcgagccgtgtgtatttccacgataacaatgtgcaggcgatg
tttgatgctttgagaaatatgaatgatttgatgcaaaaaggagctccaacaaccatgaaa
gagcacagtttccaacagacgtatagttccgatttgaaagaagcaggacgatatgtacaa
gcatttgagagtagtggaaatgtgaaagatcttaatcaggcgtgggagatttattgttcg
gttttcaaaaagctgcgtgatcaacttgccactttgaactcgttggatcttgtctacgta
tcacctaatttggtcagcgcaaaagatttggaactcgttgttcctggtacatacgatcca
tcagctccaatagtttccattcaaagtttcagctcaaaaatgaatgtaatcactagcaag
caacgtcctcgtaaaatggtgatccgtggatcaaatggtttagactatcaattcttgcta
aaaggacatgaagatccgagacaagatgaacgtgtgatgcaactttttggactagtcaac
acacttcttgccaacaattctgagacttgtcgccgcaatttgactattcaaagatactcg
attgtagctttgagcaaagattctggattgattggttgggttccaaattgtgatacactt
catacacttgtcaaggaatatcgagaaaagaaagcaaagattccattgtcgattgagcac
aaaacacttcagaaattatcacttgaaactgaacatttgactttaatgcagaagcttcaa
ttatttgaaagtgctctaagtgtaacacaaggagaagatctccgacatgtattatggttg
aagagtccgagttctgaagtttggtttgatcgacgaaccaattatacaagatcagttgca
tgtatgtcaatggttggatatattcttggtctcggtgacagacatccatccaacttgatg
ctcgatcgattgaccggaaaagttgtacacattgatttcggtgactgtttcgaagttgct
atgctccgtgaaaaattccctgaacgagttccattccgacttaccagaatgctcatcaac
gctatggaagtaactggattggacggagtatacaattacactgccgaacgtgtcttgaaa
atgttgcgaacaaatcaagaatcattgttagcagttttagaagcatttgtctatgatcca
gtaattaattggcgtcttgtggaaggaatgaaaaaggatccgaaaactagaaaagataca
ggtggacgtcagaatatggctggtgctgtattaccatcatcaagtacaactgattcaatt
atggagacgattaagaggaaactcgatgggaccgaattcgttcacactgacggatcaact
ccacctgaaccacttcaagtaactgagcaacttgcaatgctcacagagcaagcaacatct
ccattgaatttgtgtcaaagttatattggatggtgtccgttttggtag

DBGET integrated database retrieval system