KEGG   Caenorhabditis elegans (nematode): CELE_B0272.1Help
Entry
CELE_B0272.1      CDS       T00019                                 

Gene name
tbb-4
Definition
(RefSeq) Tubulin beta-4 chain
  KO
K07375  tubulin beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_B0272.1 (tbb-4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_B0272.1 (tbb-4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_B0272.1 (tbb-4)
   04147 Exosome [BR:cel04147]
    CELE_B0272.1 (tbb-4)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_B0272.1 (tbb-4)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_B0272.1 (tbb-4)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_B0272.1 (tbb-4)
  Exosomal proteins of colorectal cancer cells
   CELE_B0272.1 (tbb-4)
  Exosomal proteins of bladder cancer cells
   CELE_B0272.1 (tbb-4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 181170
NCBI-ProteinID: NP_509585
WormBase: WBGene00006538
Ensembl: WBGene00006538
UniProt: P41937
LinkDB All DBs
Position
X:complement(join(9434679..9434854,9434932..9435245,9435296..9435405,9435453..9435794,9436278..9436504,9436680..9436788,9436835..9436891))
Genome map
AA seq 444 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGAYNGDSDLQLERINVYYNEASGGKYV
PRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVV
RKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSMTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAMFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
VKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADDEGEFDEHDQDVE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaattgttcatatccaggcaggtcagtgtggtaaccaaattggggcaaagttc
tgggaagttatttccgacgagcacgggatcgatcccaccggagcatacaatggagactcc
gatttgcagttggagagaatcaatgtctactacaacgaagctagcggaggaaagtatgtc
ccacgtgcttgtcttgttgatttggagccaggaaccatggactccgttagggcaggtccc
tttggacagctctttcgaccagacaactttgtttttggtcaaagcggtgccggaaacaac
tgggccaaaggtcactacaccgagggcgccgaacttgtagacaatgttctcgacgttgtc
cgtaaagaagctgaaagctgtgattgtcttcagggattccaaatgactcactctttggga
ggaggaactggttctggaatgggaactcttttgatttccaaaattcgtgaagaatatcca
gatcgtatcatgatgactttctccgtagtgccaagtccaaaagtgtccgacacggtcgtc
gagccgtacaacgcaactctttctgttcatcaacttgttgaaaacaccgacgaaacattc
tgtattgacaacgaagccttgtatgacatctgtttccgcacgctcaagctcaccacaccg
acctacggagatttgaatcatctcgtttcgatgacgatgagtggtgtcaccacctgtctt
cgtttcccgggacagctgaatgcagatttgcgcaaattagctgttaacatggttccgttc
ccacgtcttcatttcttcatgcccggatttgctccgctcacatccagaggaagccagcaa
tacagatcgctcaccgttccagagctcacacaacaaatgttcgacgccaagaatatgatg
gcagcctgcgatccaagacacggtcgctacctgacagttgctgcaatgttccgcggaaga
atgagcatgaaagaagtcgacgagcaaatgctcaatgtgcaaaataaaaactcctcgtac
tttgttgaatggattccaaacaacgtcaaaactgctgtttgtgatattccgccaagagga
gtaaagatggcggcaacattcgtcggaaattccactgcaattcaagagcttttcaagaga
atcagtgagcaattcacagctatgttccgtagaaaagctttccttcattggtacactgga
gaaggtatggacgaaatggagtttactgaagctgagagtaacatgaatgacttggtctca
gagtatcaacagtatcaagaagcaaccgccgacgacgaaggcgagtttgatgagcacgat
caagatgtggaataa

DBGET integrated database retrieval system