KEGG   Caenorhabditis elegans (nematode): CELE_B0334.8
Entry
CELE_B0334.8      CDS       T00019                                 

Gene name
age-1
Definition
(RefSeq) Phosphatidylinositol 3-kinase age-1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00562  Inositol phosphate metabolism
cel01100  Metabolic pathways
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04070  Phosphatidylinositol signaling system
cel04140  Autophagy - animal
cel04150  mTOR signaling pathway
cel04212  Longevity regulating pathway - worm
cel04213  Longevity regulating pathway - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CELE_B0334.8 (age-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    CELE_B0334.8 (age-1)
   04068 FoxO signaling pathway
    CELE_B0334.8 (age-1)
   04070 Phosphatidylinositol signaling system
    CELE_B0334.8 (age-1)
   04150 mTOR signaling pathway
    CELE_B0334.8 (age-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_B0334.8 (age-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0334.8 (age-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_B0334.8 (age-1)
   04213 Longevity regulating pathway - multiple species
    CELE_B0334.8 (age-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_B0334.8 (age-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     CELE_B0334.8 (age-1)
Membrane trafficking [BR:cel04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    CELE_B0334.8 (age-1)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3Ka PI3K_p85B
Other DBs
NCBI-GeneID: 174762
NCBI-ProteinID: NP_496462
WormBase: WBGene00000090
UniProt: Q94125
LinkDB
Position
II:complement(join(11519708..11519839,11520548..11520680,11521118..11521468,11523214..11523588,11523640..11523900,11524572..11525848,11525897..11526457,11526510..11526795,11526882..11527054))
AA seq 1182 aa
MSMGRSPSTTFRSRTGSHGARDLIAGHGRNSRRISQMHVNILHPQLQTMVEQWQMRERPS
LETENGKGSLLLENEGVADIITMCPFGEVISVVFPWFLANVRTSLEIKLSDFKHQLFELI
APMKWGTYSVKPQDYVFRQLNNFGEIEVIFNDDQPLSKLELHGTFPMLFLYQPDGINRDK
ELMSDISHCLGYSLDKLEESLDEELRQFRASLWARTKKTCLTRGLEGTSHYAFPEEQYLC
VGESCPKDLESKVKAAKLSYQMFWRKRKAEINGVCEKMMKIQIEFNPNETPKSLLHTFLY
EMRKLDVYDTDDPADEGWFLQLAGRTTFVTNPDVKLTSYDGVRSELESYRCPGFVVRRQS
LVLKDYCRPKPLYEPHYVRAHERKLALDVLSVSIDSTPKQSKNSDMVMTDFRPTASLKQV
SLWDLDANLMIRPVNISGFDFPADVDMYVRIEFSVYVGTLTLASKSTTKVNAQFAKWNKE
MYTFDLYMKDMPPSAVLSIRVLYGKVKLKSEEFEVGWVNMSLTDWRDELRQGQFLFHLWA
PEPTANRSRIGENGARIGTNAAVTIEISSYGGRVRMPSQGQYTYLVKHRSTWTETLNIMG
DDYESCIRDPGYKKLQMLVKKHESGIVLEEDEQRHVWMWRRYIQKQEPDLLIVLSELAFV
WTDRENFSELYVMLEKWKPPSVAAALTLLGKRCTDRVIRKFAVEKLNEQLSPVTFHLFIL
PLIQALKYEPRAQSEVGMMLLTRALCDYRIGHRLFWLLRAEIARLRDCDLKSEEYRRISL
LMEAYLRGNEEHIKIITRQVDMVDELTRISTLVKGMPKDVATMKLRDELRSISHKMENMD
SPLDPVYKLGEMIIDKAIVLGSAKRPLMLHWKNKNPKSDLHLPFCAMIFKNGDDLRQDML
VLQVLEVMDNIWKAANIDCCLNPYAVLPMGEMIGIIEVVPNCKTIFEIQVGTGFMNTAVR
SIDPSFMNKWIRKQCGIEDEKKKSKKDSTKNPIEKKIDNTQAMKKYFESVDRFLYSCVGY
SVATYIMGIKDRHSDNLMLTEDGKYFHIDFGHILGHGKTKLGIQRDRQPFILTEHFMTVI
RSGKSVDGNSHELQKFKTLCVEAYEVMWNNRDLFVSLFTLMLGMELPELSTKADLDHLKK
TLFCNGESKEEARKFFAGIYEEAFNGSWSTKTNWLFHAVKHY
NT seq 3549 nt   +upstreamnt  +downstreamnt
atgtctatgggacgaagcccctccacgacatttcgaagtcgaaccggaagccatggagct
cgagatctgattgctggacacggacggaactcccgacgtatctcgcagatgcatgttaac
attttacatccacaactgcaaacgatggtcgagcagtggcaaatgcgagaacgcccatcg
ctggagaccgagaatggcaaaggatcgctgctcctggaaaatgaaggtgtcgcagatatc
atcactatgtgtccattcggagaagttattagtgtagtatttccgtggtttcttgcaaat
gtgcgaacatcgctagaaatcaagctatcagatttcaaacatcaacttttcgaattgatt
gctccgatgaagtggggaacatattccgtaaagccacaggattatgtgttcagacagttg
aataatttcggcgaaattgaagttatatttaacgacgatcaacccctgtcgaaattagag
ctccacggcactttcccaatgctttttctctaccaacctgatggaataaacagggataaa
gaattaatgagtgatataagtcattgtctaggatactcactggataaactggaagagagc
ctcgatgaggaactccgtcaatttcgtgcttctctctgggctcgtacgaagaaaacgtgc
ttgacacgtggacttgagggtaccagtcactacgcgttccccgaagaacagtacttgtgt
gttggtgaatcgtgcccgaaagatttggaatcaaaagtcaaggctgccaagctgagttat
cagatgttttggagaaaacgtaaagcggaaatcaatggagtttgcgagaaaatgatgaag
attcaaattgaattcaatccgaacgaaactccgaaatctctgcttcacacgtttctctac
gaaatgcgaaaattggatgtatacgataccgatgatcctgcagatgaaggatggtttctt
caattggctggacgtaccacgtttgttacaaatccagatgtcaaacttacgtcttatgat
ggtgtccgttcggaactggaaagctatcgatgccctggattcgttgttcgccgacaatca
ctagtcctcaaagactattgtcgcccaaaaccactctacgaaccacattatgtgagagca
cacgaacgaaaacttgctctagacgtgctcagcgtgtctatagatagcacaccaaaacag
agcaagaacagtgacatggttatgactgattttcgtccgacagcttcactcaaacaagtt
tcactttgggaccttgacgcgaatcttatgatacggcctgtgaatatttctggattcgat
ttcccggccgacgtggatatgtacgttcgaatcgaattcagtgtatatgtggggacactg
acgctggcatcaaaatctacaacaaaagtgaatgctcaatttgcaaaatggaataaggaa
atgtacacttttgatctatacatgaaggatatgccaccatctgcagtactcagcattcgt
gttttgtacggaaaagtgaaattaaaaagtgaagaattcgaagttggttgggtaaatatg
tccctaaccgattggagagatgaactacgacaaggacaatttttattccatctgtgggct
cctgaaccgactgccaatcgtagtaggatcggagaaaatggagcaaggataggcaccaac
gcagcggttacaattgaaatctcaagttatggtggtagagttcgaatgccgagtcaagga
caatacacatatctcgtcaagcaccgaagtacttggacggaaactttgaatattatgggt
gatgactatgagtcgtgtatcagagatccaggatataagaagcttcagatgcttgtcaag
aagcatgaatctggaattgtattagaggaagatgaacaacgtcatgtctggatgtggagg
agatacattcaaaagcaggagcctgatttgctcattgtgctctccgaactcgcatttgtg
tggactgatcgtgagaacttttccgagctctatgtgatgcttgaaaaatggaaaccgccg
agtgtggcagccgcgttgactttgcttggaaaacgttgcacggatcgtgtgattcgaaag
tttgcagtggagaagttgaatgagcagctgagcccggtcacattccatcttttcatattg
cctctcatacaggcgttgaagtacgaaccgcgtgctcaatcggaagttggaatgatgctc
ttgactagagctctctgcgattatcgaattggacatcgacttttctggctgctccgtgca
gagattgctcgtttgagagattgtgatctgaaaagtgaagaatatcgccgtatctcactt
ctgatggaagcttacctccgtggaaatgaagagcacatcaagatcatcacccgacaagtt
gacatggttgatgagctcacacgaatcagcactcttgtcaaaggaatgccaaaagatgtt
gctacgatgaaactgcgtgacgagcttcgatcgattagtcataaaatggaaaatatggat
tctccactggatcctgtgtacaaactgggtgaaatgataatcgacaaagccatcgtccta
ggaagtgcaaaacgtccgttaatgcttcactggaagaacaaaaatccaaagagtgacctg
caccttccgttctgtgcaatgatcttcaagaatggagacgatcttcgccaggacatgctt
gttcttcaagttctcgaagttatggataacatctggaaggctgcaaacattgattgctgt
ttgaacccgtacgcagttcttccaatgggagaaatgattggaattattgaagttgtgcct
aattgtaaaacaatattcgagattcaagttggaacaggattcatgaatacagcagttcgg
agtattgatccttcgtttatgaataagtggattcggaaacaatgcggaattgaagatgaa
aagaagaaaagcaaaaaggactctacgaaaaatcccatcgaaaagaagattgataatact
caagccatgaagaaatattttgaaagtgtcgatcgattcctatactcgtgtgttggatat
tcagttgccacgtacataatgggaatcaaggatcgtcacagtgataatctgatgctcact
gaagatggaaaatatttccacattgatttcggtcacattttgggacacggaaagaccaaa
cttgggatccagcgagatcgtcaaccgtttattctaaccgaacactttatgacagtgatt
cgatcgggtaaatctgtggatggaaattcgcatgagctacaaaaattcaaaacgttatgc
gtcgaagcctacgaagtaatgtggaataatcgagatttgttcgtttccttgttcaccttg
atgctcggaatggagttgcctgagctgtcgacgaaagcggatttggatcatttgaagaaa
accctcttctgcaatggagaaagcaaagaagaagcgagaaagtttttcgctggaatctac
gaagaagccttcaatggatcatggtctaccaaaacgaattggctcttccacgcagtcaaa
cactactga

DBGET integrated database retrieval system