KEGG   Caenorhabditis elegans (nematode): CELE_B0478.1
Entry
CELE_B0478.1      CDS       T00019                                 

Gene name
jnk-1
Definition
(RefSeq) Stress-activated protein kinase jnk-1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04141  Protein processing in endoplasmic reticulum
cel04212  Longevity regulating pathway - worm
cel04215  Apoptosis - multiple species
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_B0478.1 (jnk-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_B0478.1 (jnk-1)
   04012 ErbB signaling pathway
    CELE_B0478.1 (jnk-1)
   04310 Wnt signaling pathway
    CELE_B0478.1 (jnk-1)
   04068 FoxO signaling pathway
    CELE_B0478.1 (jnk-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_B0478.1 (jnk-1)
   04137 Mitophagy - animal
    CELE_B0478.1 (jnk-1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_B0478.1 (jnk-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0478.1 (jnk-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_B0478.1 (jnk-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_B0478.1 (jnk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_B0478.1 (jnk-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_B0478.1 (jnk-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 177460
NCBI-ProteinID: NP_001021270
WormBase: WBGene00002178
Ensembl: WBGene00002178
UniProt: Q8WQG9
LinkDB
Position
IV:join(6957677..6957722,6960209..6960318,6960727..6960885,6960933..6961018,6961142..6961271,6961321..6961518,6961797..6961962,6962123..6962221,6962270..6962348,6962406..6962482,6962526..6962641,6963467..6963592)
AA seq 463 aa
MEERLSTTSSYPSHPGRSVEEDHNTLLASSSISSIIRGTRGHLNNFIESVGNWLVPSSSG
RDDDAVSLDSCQSVYSPVRHHINSGTGGGILMEPSSIHVPENYYSVTIGEAQMVVLKRYQ
NLRLIGSGAQGIVCSAFDTVRNEQVAIKKLSRPFQNVTHAKRAYRELKLMSLVNHKNIIG
ILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHERLSYLLYQMLCGIRHLHSAGI
IHRDLKPSNIVVRSDCTLKILDFGLARTAIEAFMMTPYVVTRYYRAPEVILGMGYKENVD
VWSIGCIFGELIRGRVLFPGGDHIDQWTRIIEQLGTPDRSFLERLQPTVRNYVENRPRYQ
ATPFEVLFSDNMFPMTADSSRLTGAQARDLLSRMLVIDPERRISVDDALRHPYVNVWFDE
IEVYAPPPLPYDHNMDVEQNVDSWREHIFRELTDYARTHDIYS
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggaggaacgattatccacaacatcatcgtatccgtcacatccaggtagaagcgtggaa
gaggatcacaacactctgctcgcatcctcctcgatatcatcaatcattcgaggaacccgt
ggacacctcaacaattttatcgagtccgttgggaattggctggttccatcatcatctggt
cgagacgacgacgctgtctctttggatagttgccaatcagtgtacagtcctgttcgtcat
cacataaacagtggaacaggaggaggaattctcatggaaccatcctctattcatgttccc
gaaaactattattcggtgacaataggggaagcgcagatggttgttctcaaacgatatcaa
aatctcaggttgatcgggtctggtgctcagggaattgtttgctcagcgtttgatacggta
cggaacgaacaagttgccataaagaaattatcaaggccatttcaaaatgtgacacatgca
aagagggcttatcgagaattaaaactcatgagtcttgtaaatcataaaaatatcataggt
attctgaattgttttacaccacaaaagaaactcgacgaattcaacgatctttatattgtt
atggaacttatggatgcaaatctttgtcaagtgattcaaatggatttggatcatgagaga
ttatcatatcttctttatcaaatgttatgtggtatcaggcatttacatagtgctggaatt
atacacagggatttgaaaccatcaaacattgtcgttcgaagtgattgtactctaaaaatc
ttggatttcggattggctcgaactgcgattgaggcattcatgatgactccttacgttgtg
acaagatactatcgggcaccggaagttattttaggaatgggttacaaggaaaatgttgat
gtttggtcaattgggtgtatatttggagagctgatacgtggacgtgtactattcccgggt
ggtgaccatatcgatcagtggactaggattattgaacaattgggtactccggataggtca
tttttagaacggttacaaccaactgtcagaaattatgtggaaaatcggccaagatatcaa
gcaacgccgtttgaagttctcttcagtgataacatgttcccaatgacagctgacagctca
agacttacaggtgctcaagctcgtgacttactttctcgaatgttagtcatagatccggaa
agaaggatttctgtggatgatgcactgagacatccatatgtcaatgtttggtttgatgaa
attgaagtatatgctccacctccacttccgtatgatcataatatggatgtggaacagaac
gtggattcatggagagagcacattttccgagagctcacagattacgcaagaacccatgac
atttattcctga

KEGG   Caenorhabditis elegans (nematode): CELE_T07A9.3
Entry
CELE_T07A9.3      CDS       T00019                                 

Gene name
kgb-1
Definition
(RefSeq) GLH-binding kinase 1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04141  Protein processing in endoplasmic reticulum
cel04212  Longevity regulating pathway - worm
cel04215  Apoptosis - multiple species
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_T07A9.3 (kgb-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_T07A9.3 (kgb-1)
   04012 ErbB signaling pathway
    CELE_T07A9.3 (kgb-1)
   04310 Wnt signaling pathway
    CELE_T07A9.3 (kgb-1)
   04068 FoxO signaling pathway
    CELE_T07A9.3 (kgb-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_T07A9.3 (kgb-1)
   04137 Mitophagy - animal
    CELE_T07A9.3 (kgb-1)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_T07A9.3 (kgb-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_T07A9.3 (kgb-1)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_T07A9.3 (kgb-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_T07A9.3 (kgb-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_T07A9.3 (kgb-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_T07A9.3 (kgb-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 176866
NCBI-ProteinID: NP_499922
WormBase: WBGene00002187
Ensembl: WBGene00002187
UniProt: O44408
LinkDB
Position
IV:complement(join(405948..406091,406150..406256,406303..406563,406733..406904,406954..407038,407747..407862,407906..408035,408686..408777,408821..408886))
AA seq 390 aa
MEVDLPVHNEYDASRFHQVTIRDPIAGADSTFTIPTRYVNLSFLNAGAQGTVVMADDLVT
TQRVAIKKMQQPFVMTMSAKRAYREFILLTTIKHPNIIRLLNAFTPDTSLSTFREVYLVM
ELMTHNLHEVIHRLRLDHKTLSFFVYQSLCAIKHLHNSGVIHRDLKPSNIVVNDRCVLKV
LDFGLARKKNVDTSMRMSDYVVTRYYRAPEVILGLPYSEKVDIWSVGCIFAEMINHTVLF
PGKDRIDQWTKIYSVLGTPDDHFISQLGQSAAMYVRSLPRHQARAFSEIVPDTNFLPETE
NPRVHLTPHVARDLLFNMLKINPEERYSVEDALNHPYVKLWFKDDEVNAPASENRYDQEI
DFADKTLIEWKELIFNEVQRYQADHDIFTG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaagtggatctgccggtacataacgagtatgatgcgtctagatttcatcaagttaca
attagggacccgatagccggcgcggacagcactttcactattccaactcgttatgtaaac
cttagttttctgaatgccggcgcccaaggaactgtcgtaatggccgatgacctagtaaca
acgcaacgtgtggcaatcaagaagatgcaacaaccatttgtgatgacaatgagcgcaaag
cgagcatatcgagagtttatactgctaacgactatcaaacacccaaatataatccgtcta
ctaaacgcgtttacaccggacacttcactttcaacgttccgagaagtatatctagttatg
gaattaatgacacacaatttgcacgaggttatacatcgattaagattggaccataaaaca
ttatcattcttcgtctaccagagtttgtgcgcaatcaagcatcttcacaattcgggagtc
attcatcgtgacttaaaaccatcgaatattgtcgtcaacgatcgatgtgtattaaaagtt
ttagactttggattggcccggaagaagaatgtggacacatcgatgagaatgtcagattat
gtggtgacaagatactacagagcccccgaagttatattaggtcttccctattcggaaaaa
gtagatatttggtcagtcggatgtatatttgctgaaatgatcaaccataccgtacttttc
cctggaaaagatcgaattgatcaatggactaaaatttatagtgttttgggaacaccagat
gatcatttcattagtcaattgggtcagtcagctgctatgtatgttcgatcgttgccacgt
catcaggcacgagcattcagtgaaatcgttcctgataccaattttctgccggagactgaa
aatccaagggtccatttgacaccacacgtggctcgtgatctcctgttcaatatgttgaaa
atcaatcctgaagaaaggtattcagttgaagatgcactgaatcatccatatgttaagttg
tggtttaaggacgatgaggtaaacgcccccgcatcagaaaatcgatacgatcaggaaatt
gattttgccgataagacacttattgaatggaaagagctaattttcaacgaagtgcaacgc
tatcaagccgaccacgacattttcactggataa

KEGG   Caenorhabditis elegans (nematode): CELE_ZC416.4
Entry
CELE_ZC416.4      CDS       T00019                                 

Gene name
kgb-2
Definition
(RefSeq) Mitogen-activated protein kinase
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04012  ErbB signaling pathway
cel04068  FoxO signaling pathway
cel04137  Mitophagy - animal
cel04140  Autophagy - animal
cel04141  Protein processing in endoplasmic reticulum
cel04212  Longevity regulating pathway - worm
cel04215  Apoptosis - multiple species
cel04310  Wnt signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CELE_ZC416.4 (kgb-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_ZC416.4 (kgb-2)
   04012 ErbB signaling pathway
    CELE_ZC416.4 (kgb-2)
   04310 Wnt signaling pathway
    CELE_ZC416.4 (kgb-2)
   04068 FoxO signaling pathway
    CELE_ZC416.4 (kgb-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_ZC416.4 (kgb-2)
   04137 Mitophagy - animal
    CELE_ZC416.4 (kgb-2)
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_ZC416.4 (kgb-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZC416.4 (kgb-2)
  09149 Aging
   04212 Longevity regulating pathway - worm
    CELE_ZC416.4 (kgb-2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_ZC416.4 (kgb-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CELE_ZC416.4 (kgb-2)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   CELE_ZC416.4 (kgb-2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 191169
NCBI-ProteinID: NP_500384
WormBase: WBGene00002188
Ensembl: WBGene00002188
UniProt: H2KZI0
LinkDB
Position
IV:join(3606796..3606834,3606878..3606969,3607189..3607318,3607360..3607475,3607843..3607927,3607981..3608146,3608215..3608475,3608522..3608623,3609004..3609011)
AA seq 332 aa
MNLPSKFHQVTITDPIAGAGITFTIPTRYVNLKFLNVGAQGIVVMADDLVTTQRVAIKKM
QQPFLLTMSARRAYREFILLTTLKHPNIIRLLNAFTPDTSLSSFQEVYLVMEFMTHNLHE
VIHRLRLDHETLSFLVYQSLCAIKHLHNLGFIHRDLKPSNIVVNERCVLKVLDFGLARRR
NVDMRMSDYVGTRYYRAPEVILGLNYSEKVDIWSVGCILAEMINHTVLFPGKDIRDQWTQ
ISSVLRTPDDHFINQLEPIGAVYVRSLPQHLARAFNEIVPDSNFLPETENPKDHLTLHMA
RDLLFNMLKINPEERYSVEDALNHPYTMVQGR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaatttaccttccaaatttcatcaagttactattacggacccgatagccggcgcgggc
attactttcactattccaacccgttatgtcaaccttaaatttttgaatgtcggcgctcag
gggattgtcgtaatggccgatgacctagtgacaacacaacgcgtagcaatcaagaagatg
caacaaccatttctgttgacaatgagtgcaaggcgagcatatcgagaatttatactgcta
acgactctgaaacacccaaatataatccgtctgctaaacgctttcacaccggatacttca
ctttcatcgtttcaagaggtatatctggttatggaatttatgacacacaatctacacgag
gtgatacatcgattaagattggatcatgaaacattatcattcttggtctaccagagtttg
tgcgcaatcaagcaccttcacaatttgggattcattcatcgtgacttaaaaccatcgaat
attgtcgtgaacgaacgttgtgtgttaaaagtcttagacttcggattggcaagaagacgc
aacgtggacatgagaatgtcagattatgtggggacaagatactacagagcccccgaggtt
attttgggtctgaactattcggaaaaagtagacatttggtcagtcggatgtatacttgct
gaaatgatcaaccataccgttcttttcccgggcaaagatatacgtgatcaatggacacaa
atttctagtgtattaagaacaccagacgatcatttcattaatcaattagaaccaataggc
gctgtgtatgttcgatcgttgccacaacatctagcacgtgctttcaatgaaatagttccg
gattccaattttctgccggagactgagaacccgaaggatcatttgacactacacatggct
cgtgatctcctgttcaatatgttgaaaatcaatcctgaagaacggtattcagttgaagat
gcacttaatcatccatatactatggttcaaggacgatga

DBGET integrated database retrieval system