KEGG   Caenorhabditis elegans (nematode): CELE_B0545.1
Entry
CELE_B0545.1      CDS       T00019                                 

Gene name
tpa-1
Definition
(RefSeq) Protein kinase C-like 1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04140  Autophagy - animal
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    CELE_B0545.1 (tpa-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_B0545.1 (tpa-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cel01001]
    CELE_B0545.1 (tpa-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     CELE_B0545.1 (tpa-1)
Protein kinases [BR:cel01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   CELE_B0545.1 (tpa-1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C Zf_RING zf-RING_9 C1_2 Act-Frag_cataly Pkinase_fungal Kdo PHD
Other DBs
NCBI-GeneID: 176825
NCBI-ProteinID: NP_001359808
WormBase: WBGene00006599
LinkDB
Position
IV:join(92052..92077,92804..92910,93685..93830,98788..98890,103933..104007,104051..104271,105006..105135,105652..106181,107229..107383,107816..108287,110002..110151)
AA seq 704 aa
MAQAENACRLKLLRADVPVDLLPAGCSATDLQPAVNVKEKIEVNGESRLVQKKKTLYPEW
EKCWDTAVAEGRILQIVLMFNQTPVVEATMRLEDIISKCKSDAITHIWINTKPNGRILAQ
TRHLKNAPDDDHPVEDIMTSRSNSGPGIQRRRGAIKHARVHEIRGHQFVATFFRQPHFCS
LCSDFMWGLNKQGYQCQLCSAAVHKKCHEKVIMQCPGSAKNTKETMALKERFKVDIPHRF
KTYNFKSPTFCDHCGSMLYGLFKQGLRCEVCNVACHHKCERLMSNLCGVNQKQLSEMYHE
IKRGTHATASCPPNIANLHLNGETSKNNGSLPNKLKNLFKSHQYSVEEQKETDEYMDNIW
GGGDGPVKKFALPHFNLLKVLGKGSFGKVMLVELKGKNEFYAMKCLKKDVILEDDDTECT
YIERRVLILASQCPFLCQLFCSFQTNEYLFFVMEYLNGGDLMHHIQQIKKFDEARTRFYA
CEIVVALQFLHTNNIIYRDLKLDNVLLDCDGHIKLADFGMAKTEMNRENGMASTFCGTPD
YISPEIIKGQLYNEAVDFWSFGVLMYEMLVGQSPFHGEGEDELFDSILNERPYFPKTISK
EAAKCLSALFDRNPNTRLGMPECPDGPIRQHCFFRGVDWKRFENRQVPPPFKPNIKSNSD
ASNFDDDFTNEKAALTPVHDKNLLASIDPEAFLNFSYTNPHFSK
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggcacaggctgagaatgcgtgtcggctgaagcttcttcgagcggacgttccagttgac
ttacttccggccggatgttcagcaactgatttgcagccggctgttaatgtgaaggagaag
attgaagtgaatggtgaatcccgactagtccaaaagaagaagaccctttacccggaatgg
gaaaaatgttgggataccgcagttgccgagggccgaattctacaaattgtgctcatgttt
aatcagacacctgtggtcgaagcaactatgcgattagaggatataatctcaaaatgcaaa
agcgacgcgatcactcacatttggatcaatactaaaccaaacggacggattcttgcgcag
acaagacatttgaagaatgcaccggatgacgatcaccctgtagaggacataatgacatcc
agaagcaactccggtcccggaattcaacgtcgtagaggagcgataaaacatgcgcgagta
cacgagattcgcggccatcagttcgtcgccaccttcttccgacaaccccatttctgttcg
ttgtgctccgatttcatgtgggggctcaacaaacagggatatcagtgtcagttgtgctcg
gccgccgtgcacaaaaaatgccacgagaaagtgattatgcagtgcccgggaagtgcaaag
aatacaaaggagactatggctctcaaagaacgatttaaagtggacataccgcatcgattc
aagacgtataacttcaaaagtcccacgttttgtgatcactgtggttcaatgctttacgga
ctttttaaacaaggactacggtgtgaagtatgcaacgtggcgtgtcatcacaaatgcgag
cggctcatgtcaaacctgtgtggtgtaaatcaaaagcaactcagcgagatgtaccatgaa
attaaacgtggcacccacgccacagcaagctgtccgcccaacattgccaaccttcatttg
aacggagagacgagtaagaacaatggaagtctgccgaacaagttgaagaatctattcaag
tcacaccagtatagtgtagaagaacaaaaggagaccgacgagtatatggataatatttgg
ggcggtggagatggccctgtcaaaaaattcgccctacctcatttcaatttgctcaaagtg
cttggaaaaggatcgtttggaaaggttatgctggtggaattgaaaggaaaaaatgagttt
tatgcaatgaaatgtctgaaaaaggacgtgatattggaggatgatgatacggaatgtact
tatattgaacgacgagtgctcattttggcgagccagtgcccgttcttgtgtcaattgttt
tgctcgttccagactaatgaatacctcttcttcgtaatggaatacttaaatggtggtgat
ctgatgcaccatattcaacaaatcaaaaaatttgatgaagcccggacacgcttttatgca
tgtgaaattgtggtggctctgcagtttttgcacactaataatattatctatcgtgatctc
aagcttgataatgtgctgttagactgtgatggtcacataaagcttgccgattttggtatg
gcaaaaaccgagatgaatcgagaaaacggaatggctagcacattctgtggaacaccggat
tatatcagtcctgaaattatcaagggtcaactttacaatgaagctgtcgatttttggtca
tttggagttttgatgtatgaaatgctcgtcggacaatcaccgttccatggagaaggagaa
gatgaattatttgattcaattcttaatgagaggccatatttcccgaaaactatatcgaag
gaagcagcgaaatgtctatcagccttattcgatagaaatccgaatacccggctaggaatg
cctgaatgccctgatggtccaatcaggcaacattgcttcttccgaggtgtcgactggaaa
cggtttgaaaatcgacaggttccgccaccgtttaagccgaacattaaatccaactcggac
gcctcgaacttcgacgacgacttcacgaacgagaaggcggcgttgacacctgtgcacgac
aagaacctactggcttcaatcgatcctgaagcattccttaacttctcttatacgaatcct
cacttctcaaaatag

DBGET integrated database retrieval system