KEGG   Caenorhabditis elegans (nematode): CELE_C05B10.1
Entry
CELE_C05B10.1     CDS       T00019                                 

Gene name
lip-1
Definition
(RefSeq) Dual specificity protein phosphatase lip-1
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_C05B10.1 (lip-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C05B10.1 (lip-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_C05B10.1 (lip-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CELE_C05B10.1 (lip-1)
    3.1.3.48  protein-tyrosine-phosphatase
     CELE_C05B10.1 (lip-1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    CELE_C05B10.1 (lip-1)
SSDB
Motif
Pfam: DSPc PTPlike_phytase Init_tRNA_PT Y_phosphatase
Other DBs
NCBI-GeneID: 191704
NCBI-ProteinID: NP_001293707
WormBase: WBGene00003043
Ensembl: WBGene00003043
UniProt: V6CIV8
LinkDB
Position
IV:join(6842964..6843028,6843076..6843147,6843224..6843320,6843415..6843680,6844068..6844190,6844245..6844375,6844423..6844540,6844589..6844715,6845006..6845152)
AA seq 381 aa
MTTHLPSTSQNGEEISAEQFNRIFHERNVIVLDCRSNGDSVKRANRFFCSLRLPALLQRR
LMGGSMRLSTVPDLKDLNNSPDQCPEVLLIPGDSEQDEQLSAALARNLKSNHYRHFVLGE
PVKTLLSQFPTLRDAADENWNTTFQMNSMPGQASGQQASSGPLLNLNQLRLEGEDQGGKQ
RAEFPVKLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEEDPNMRYLRISADD
NASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEW
VQKRNASIAPNFHFMGQLTDYEKMLGLNSNRVGTYPSSAPRSPSCAIEAAAVSQVGGLLT
PPPTSCSASPQSSNHSAKSFH
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgacaactcacctaccgagcacatctcaaaatggcgaagagatatctgctgagcaattc
aacaggatatttcacgaacgcaacgtcatcgttctggattgtcgatcaaatggtgattca
gtgaaacgagccaatcgattcttttgcagtcttcgattaccggctctccttcaacgccgt
ttaatgggcggttcaatgcgactttcaacagtacctgatctgaaggatctgaataattct
cctgatcaatgtcccgaagttcttctcatccccggcgacagtgaacaagacgagcagctc
tcggcagctttagctcgaaatctgaaatccaaccactatcgtcattttgtgctcggcgag
cctgtcaagacacttctctcccagtttccgacccttcgtgatgcagccgacgaaaattgg
aacaccacgtttcaaatgaactcgatgccgggtcaagcaagtgggcaacaagcatcaagt
ggaccgcttcttaacttaaaccaactccgattggaaggtgaagatcaaggcggaaaacaa
cgtgcagagtttcctgtaaagttaaccaatttcttgtatcttggaaacgcggagaccgct
aaaaatcgagatgttcttaaaaaatattctatctcacatgtaataaatgtcacatcaaat
ttgccaaacacgttcgaagaagacccaaatatgcgatatttaagaatatcggccgatgat
aacgcttcacataatctaacaaaattcttccctgaagccatatccttcattgatgatgcg
cgacgcaacgattcagcatgtcttgtgcattgtctggctggaatttccagaagcgttaca
atatgtctggcgtatctcatgaagactgaaatgtgtactcttgattctgcctacgaatgg
gttcaaaagagaaatgcaagcattgctccaaattttcattttatgggacaactcacagac
tacgagaagatgttgggattgaatagcaatcgagtcgggacatatccttcctcggctcct
cgttctccatcttgtgccatcgaagcagcagcagtatcacaagttggaggccttctaact
ccaccaccaacaagctgttcggcgtcacctcaatcgagtaatcactcggcaaagtcattt
cactag

KEGG   Caenorhabditis elegans (nematode): CELE_F08B1.1
Entry
CELE_F08B1.1      CDS       T00019                                 

Gene name
vhp-1
Definition
(RefSeq) Tyrosine-protein phosphatase vhp-1
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F08B1.1 (vhp-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F08B1.1 (vhp-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cel01009]
    CELE_F08B1.1 (vhp-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CELE_F08B1.1 (vhp-1)
    3.1.3.48  protein-tyrosine-phosphatase
     CELE_F08B1.1 (vhp-1)
Protein phosphatases and associated proteins [BR:cel01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    CELE_F08B1.1 (vhp-1)
SSDB
Motif
Pfam: DSPc Rhodanese Y_phosphatase
Other DBs
NCBI-GeneID: 173904
NCBI-ProteinID: NP_001343753
WormBase: WBGene00006923
LinkDB
Position
II:join(5323276..5323284,5331486..5331671,5334528..5334649,5334698..5334801,5338172..5338356,5338740..5339014,5339075..5339966,5340035..5340247)
AA seq 661 aa
MLKNMTVLDTVTISTCGLAALIREAPDTTLVVDCRGFTEYNESHVRHSMNAFFSKLIRRR
LFENKLDDNCLIHQLMSCSSGCTKMDEKLDLVLYAEEDKPRGNKRRIASCNAPESTAKIM
RVLRERLEDTDKFRSVMVLEGGFKQFAQQYPQLCESSEGMTRLPQSLSQPCLSQPTGDGI
TLITPNIYLGSQIDSLDETMLDALDISVVINLSMTCPKSVCIKEDKNFMRIPVNDSYQEK
LSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERR
PSISPNFNFMGQLLEYENVLIKDHVLDYNQASRPHRHMDYYGPSDLCPPKVPKSASSNCV
FPGSTHDESSPSSPSVSEGSAASEPETSSSAASSSSTASAPPSMPSTSEQGTSSGTVNVN
GKRNMTMDLGLPHRPKALGLPSRIGTSVAELPSPSTELSRLSFNGPEAIAPSTPILNFTN
PCFNSPIIPVASSSREVILTLPTPAASSSSSTSSEPSFDFSSFESSSSSSIVVENPFFAS
TEVPAGSSSISTPSGSQSTPASASSSAASRCRMKGFFKVFSKKAPASTSTPASSTPGTSR
AARPECLRSSGIIISAPVLAITEEEDAESPESGFNEPEVGEEDDDSVSICSTSSLEIPCH
Q
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgctcaagaatatgacagtacttgacacagtcacaatctctacatgcgggttggctgca
cttattcgcgaggctccagacacaacgcttgttgtcgattgtcgtggatttacagaatac
aatgaatctcatgttcgacactctatgaatgcatttttctcgaaactcatcagaagacgt
ctttttgaaaataagctcgacgataactgcttaattcatcaattgatgagctgctcgtca
ggttgcacaaaaatggatgagaagcttgatttagttttatacgcagaagaagataagcca
cgtggaaacaagagacgaatcgcgtcgtgtaatgctccagaatccactgcaaaaatcatg
cgagttctgagagaacgactcgaggacactgacaaatttcgaagcgtcatggttcttgaa
ggtggcttcaaacaattcgcacaacaatatcctcaattgtgcgagagttcagaaggaatg
actcgtttgccacaaagcctctcacaaccatgtctatcccaaccaactggagatggaatc
acattgatcactccaaatatttatctcggaagtcaaattgatagcttggatgagaccatg
ttagatgctcttgatatcagtgttgtcatcaacctttctatgacttgccccaaatccgta
tgcatcaaagaagataagaattttatgagaatcccagtaaatgactcctatcaagaaaaa
ctttctccatattttccaatggcttatgaatttcttgaaaaatgcagaagagccggaaag
aagtgcctgattcattgtttggctggcatttctagaagccccacactggctatttcgtat
attatgcgctacatgaaaatgggaagcgatgatgcatacagatatgtgaaagagcgtcgc
ccttcgatctcgccaaacttcaattttatgggacaattgcttgaatacgagaatgtttta
atcaaagatcatgtgcttgactacaatcaagcttcaagaccacaccgacatatggactac
tatgggccatctgatctgtgtccaccaaaggttccaaaaagtgcatcatccaactgtgta
ttccctggaagtactcatgatgaatcatcaccatcttctccttctgtatcagaaggatca
gctgcaagtgagcctgagacatcatcatcagctgcttcatcttcatcaactgcatctgca
cctccatcgatgccttctacaagtgaacaaggaacatcgtcaggaacagttaatgtcaat
ggaaagagaaatatgaccatggatttgggacttccccatcgcccaaaagctcttggactt
ccatcaagaatcggtacttctgttgcggagctgccgtctccatcaactgaactttcgaga
ttaagctttaatggtccagaagcaattgctccatctactccaattcttaactttaccaac
ccatgtttcaattctccaatcatcccagttgcatctagctcgcgagaagttattctgacc
cttccaactccagctgcttcatcttcttcttcaacatcatctgaaccatcttttgatttc
tcatcatttgaatcttcatcatcgtcttcaattgttgtcgagaacccatttttcgccagc
acagaagtgcctgctggatcatcatcgatatccacaccatctggatcacaatcaactcca
gcatctgcttcttcatcagctgcttctagatgcagaatgaagggattctttaaagtattc
agcaagaaggctccagcttcaacttccaccccggcttcctcaacccctggaacttcccga
gcagctcgtccagaatgtctccgatcatccggcatcattatctcagcaccagttcttgca
attacagaagaagaagatgccgagtctccagaatcggggtttaacgaacccgaagtcgga
gaagaagacgatgattcggtgtcaatttgctcgacgagctctttggaaattccgtgtcac
cagtaa

DBGET integrated database retrieval system