KEGG   Caenorhabditis elegans (nematode): CELE_C05D2.3
Entry
CELE_C05D2.3      CDS       T00019                                 

Gene name
basl-1
Definition
(RefSeq) BAS-Like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00350  Tyrosine metabolism
cel00360  Phenylalanine metabolism
cel00380  Tryptophan metabolism
cel01100  Metabolic pathways
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_C05D2.3 (basl-1)
   00360 Phenylalanine metabolism
    CELE_C05D2.3 (basl-1)
   00380 Tryptophan metabolism
    CELE_C05D2.3 (basl-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C05D2.3 (basl-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C05D2.3 (basl-1)
Enzymes [BR:cel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CELE_C05D2.3 (basl-1)
    4.1.1.105  L-tryptophan decarboxylase
     CELE_C05D2.3 (basl-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C05D2.3 (basl-1)
SSDB
Motif
Pfam: Pyridoxal_deC
Other DBs
NCBI-GeneID: 175779
NCBI-ProteinID: NP_498210
WormBase: WBGene00015467
Ensembl: WBGene00015467
UniProt: O45138
LinkDB
Position
III:join(5614972..5615094,5615141..5615815,5615971..5616097,5616143..5616351,5616396..5616494,5616643..5616747,5616979..5617053,5617098..5617214)
AA seq 509 aa
MDSAKLRVEGKKMIEIVANYWDGIRTRKPIPDVKPGYIEKSVPSNPPTTPESWEKVFGDL
EKVIFNGSSHWNHPHFFAYFSAGIGYHSILADIISSGLGSVGFTWIACPPITELEKITLD
WLVDLTSLPVEFKNSHPGHGCGIIQSSASDSTLIAIMTARAAKVEFIKQNPSTFQWLINS
TSEHLRSISYWTPVNRTIHDSTDIITPYYHDPRVFKNFVMYFTDQAHSSVEKGAMLAGVR
FRKLRSVRGYMENYEMDSKILIDAIEQDRSRGFIPFMVALTVGTTATCAADDVEKIGQIC
QKEGLYLHGAFAFCDEFKYLVNGLKYVDSYNTDLHKAGMINFDCCPLWFKNGTYASRYYN
VDPVYLAHEYQSSNMDYRHLEVPLGRRFRSLKVWFTMRNMGVEKIREYQRKTVSLALLFT
KIIVEGDKFELFTPPHLGMATFRLKNHTNSDNERLLQAINRDRRIHLGISMVHGVYVLRF
CVGSPLTNEEDVHFTKSVIFEIAHFLFEA
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggattccgcaaagcttcgagtcgagggaaagaagatgattgaaattgtggcaaactac
tgggatggaataaggacccgcaaaccgattccggatgtgaagcctggttatattgagaaa
tcggtgccatctaatcctccaaccacgccggaatcttgggaaaaagtgtttggcgatctg
gagaaggtgatcttcaacggaagcagccactggaaccatccacatttttttgcctacttc
tccgctggaattggttatcactcgattctggccgacattattagtagtggacttggatct
gttggattcacgtggatcgcgtgtcctccgatcactgagcttgagaagatcacattggat
tggctcgtagatttgacgagtcttcccgtggagtttaagaattcccatccaggtcatggt
tgtggaattattcagagctctgcatccgattcaacgctcatcgcaatcatgactgcaaga
gctgcaaaggtggagttcatcaaacagaatccatcaactttccaatggcttattaactca
acttctgagcatcttcggagcatctcctactggactcccgtgaatcggacaatccatgat
tccactgacatcatcactccgtactatcatgatcccagagttttcaagaactttgtgatg
tacttcactgaccaggcacactcttccgttgaaaagggagcaatgttggctggagttagg
ttcaggaaactgagaagtgtgaggggatatatggagaattacgaaatggattcaaagatt
ttgatcgacgctatagagcaagaccgttcccgtggcttcatcccatttatggtggctctc
acagtcggaacaactgccacgtgtgcagctgatgatgttgagaaaatcggtcaaatctgt
cagaaagagggtctctatctccatggtgcctttgccttctgcgatgagttcaagtatctg
gtgaatgggctcaaatacgtggattcctacaatactgatctccacaaggcgggaatgatc
aactttgattgttgtccactttggtttaaaaatggaacgtatgcatccagatattacaac
gtagatcctgtctacttggcacacgagtatcaatcctcaaatatggattatcggcatctg
gaagtgccattgggtcggagatttagatctctgaaagtttggttcacgatgagaaatatg
ggcgtcgagaagatcagagagtatcaaagaaagaccgtgtccctcgctttgctcttcaca
aaaatcattgtggagggtgataagtttgaactctttacaccaccacaccttggaatggct
accttccgtttgaaaaatcacaccaactctgacaacgagcgtctcttgcaagccatcaac
cgtgaccgccgtatccacttgggtatctccatggtccatggagtctacgtgctacgtttc
tgtgtgggaagtccgctgacaaacgaggaagatgttcatttcacgaaaagcgtaattttt
gagattgctcattttctgtttgaagcctga

KEGG   Caenorhabditis elegans (nematode): CELE_C05D2.4
Entry
CELE_C05D2.4      CDS       T00019                                 

Gene name
bas-1
Definition
(RefSeq) Biogenic Amine Synthesis related
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00350  Tyrosine metabolism
cel00360  Phenylalanine metabolism
cel00380  Tryptophan metabolism
cel01100  Metabolic pathways
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    CELE_C05D2.4 (bas-1)
   00360 Phenylalanine metabolism
    CELE_C05D2.4 (bas-1)
   00380 Tryptophan metabolism
    CELE_C05D2.4 (bas-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C05D2.4 (bas-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C05D2.4 (bas-1)
Enzymes [BR:cel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     CELE_C05D2.4 (bas-1)
    4.1.1.105  L-tryptophan decarboxylase
     CELE_C05D2.4 (bas-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C05D2.4 (bas-1)
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Other DBs
NCBI-GeneID: 175778
NCBI-ProteinID: NP_001021151
WormBase: WBGene00000239
Ensembl: WBGene00000239
UniProt: O45137
LinkDB
Position
III:join(5612289..5612411,5612551..5613018,5613145..5613171,5613384..5613593,5613640..5613993,5614040..5614138,5614208..5614312,5614418..5614603)
AA seq 523 aa
MDSQKLRTEGKKMLDFVADYWDGIRDRKPLPDVKPGYINDLVPAQAPATPEDWAKIFDDL
ENVVVNGATHWHHPHFFAYFPTALSYQSIMADILSGGIAGIGFTWKSCPSMTELEMSSLD
WVVDLMGLPEHFKNSHNGPGCGIIQSTASDSTMIAIMAARATHVERIKSEPTFMKWVSET
GVGKTLKNIFDRVKVNKTLVARASVTVDDEASGMITPYFHDPTVFERFVMYCSDQAHSSV
EKGAMLSAVRMRKLKATRGFLGNYGVSRETLQNAIKEDRARGYIPFMFLATVGTTCSCGV
DQVDELGPVCVEEGLYLHVDAAYAGTFALCEEFKYLIRGMEHVDSFNFNLHKAGMVNFDC
SPMWFKNGTHVSRYFNVDAVYLAHEYQTTASDYRHLQVALGRRFRSLKIWFVLRNMGVDK
IREYLRRTELLAAEFSKLILENGKFEHFVPQHLGLTCFRLKNSTNADNEKLCNAINDDRR
IHLVPSTVHGTYFLRMVVCSQLTTLDDIIYARDVIFELAEKLF
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggactcccaaaaattgcggactgagggtaagaagatgctggattttgtggcggactac
tgggatggtattcgtgatagaaaaccactgcctgatgttaaaccaggatatattaatgat
ttggtaccagcccaagcccctgccaccccagaagactgggcaaaaatctttgacgatctc
gaaaatgtggtggtgaacggagccactcactggcaccacccacacttcttcgcatacttt
ccaacagctctcagctatcaatcgatcatggctgatatcctatccggcggaattgctgga
atcggattcacatggaaatcgtgcccatcaatgacagaactagaaatgtcatctttggat
tgggtggttgatcttatgggattaccagaacatttcaaaaactcacataatggtccagga
tgtggaattattcaaagtaccgcatcggatagtacaatgattgccattatggctgcgaga
gctacacatgttgagagaatcaagtcggagccaacttttatgaaatgggtctctgaaact
ggagttggcaagacactcaaaaacatattcgatagagtcaaagttaacaagacgttggtt
gcacgagcttcagtgactgtggacgacgaagcatctggaatgataacaccgtacttccac
gatccaacagtttttgagagatttgtcatgtattgctctgaccaggctcactcttccgtt
gaaaaaggagcaatgctctccgccgttcgaatgaggaaactcaaggcgacacgtggattt
ttaggaaactacggagtttccagggagacacttcagaacgctattaaagaagaccgtgcc
cgcggttatattccattcatgttcctggcgactgtcggaaccacatgttcttgtggagtt
gatcaggtcgatgagctcggcccagtctgtgtagaagagggtttgtatctacacgttgac
gcagcatatgctggaacatttgctctctgcgaggagttcaagtacttgatccggggtatg
gagcacgtggattcattcaatttcaacctacataaagctggaatggttaactttgactgc
tcgccaatgtggttcaagaacggaactcatgtatcccgttatttcaatgtagatgccgta
tatctagctcacgaatatcaaacaactgcctcagattataggcacttacaagtcgccttg
ggccggagattcagatctctgaaaatttggtttgtcctcagaaatatgggcgtcgacaag
attcgcgagtatctgagacggaccgagctcttggctgctgaattctccaagttgattctg
gaaaacggaaagtttgagcatttcgtgccgcagcatttgggactcacatgtttccgattg
aaaaatagcaccaacgcggataatgagaagctctgtaacgcaatcaatgatgatcgcaga
atccacttggttccatcaacagttcacggaacctatttccttcgaatggttgtttgcagt
cagctaacaactctagatgacattatttacgcccgtgacgtcatctttgaactcgccgag
aaattattctaa

DBGET integrated database retrieval system