KEGG   Caenorhabditis elegans (nematode): CELE_C07G1.1
Entry
CELE_C07G1.1      CDS       T00019                                 

Gene name
svh-1
Definition
(RefSeq) Serine protease svh-1
  KO
K23489  HGF/MSP/plasminogen-like protein
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C07G1.1 (svh-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_C07G1.1 (svh-1)
Peptidases and inhibitors [BR:cel01002]
 Serine peptidases
  Family S1: chymotrypsin family
   CELE_C07G1.1 (svh-1)
SSDB
Motif
Pfam: Trypsin Ldl_recept_a SRCR_2 SRCR Kringle Trypsin_2
Other DBs
NCBI-GeneID: 182375
NCBI-ProteinID: NP_501379
WormBase: WBGene00006620
Ensembl: WBGene00006620
UniProt: Q17800
LinkDB
Position
IV:join(8206749..8206840,8207014..8207255,8207336..8207503,8207690..8207766,8207912..8208177,8208228..8208540,8208798..8208951,8208999..8209125,8209914..8210144,8210586..8210837,8212445..8212590,8212636..8212769,8212815..8212885,8212934..8213052,8213156..8213308,8213356..8213666)
AA seq 951 aa
MYIVIVTMRTILFFGIFFIFIFQCAKCIELKIFEDLLEVRSQSGLFFPLCSKSFHQKYGE
QACASISSTFLSYSTVSLQQYTYSVGCTTSVCFTFLSSFCKTGVKVFCSPSLCASGTLQI
GSKCLSISTVPVQGYSEANYYCNPATLISSLKPTEIESIRDTILPTFADTRLFLTSGLRQ
GATWKWGNGDTVEQEVTGTGRCLALQAGNLVAIDCDSEAYVFCESGRECIARDKEYSGTA
NRTSDGKMCLMWNDPTVLFRRERDLEILNHNFCRFVNDADGKKSATPVCYTKPNELSQCY
IPPCPESFNDVVPIESGDSCPIGSISCDNGSKCISEKFQCDYEVDCNDGSDEHNCEDYLQ
YYELIGAYRLADNIIEVWTFIPHVQGCARKCRESLLMCEAFSYEPKSQTCLLTDTSQTFS
SLARKITSLYYRRRFSTKDVEFQVENKVLYATKSAKKGHVCDDNYSREKLSSICRVLGFG
DPIYTVESHQSESSLGPLQPTTLHPTNPSFDSPSSVSQMRRTSPSATLAPRLPAWNLSCL
REPNCTSTVISTCEPIRCSHCQQAACGDGSCIRFDQLCNGQIDCQSGEDEDYCRANSFRL
TNGSDTSGYLEVLFRSRWEPICADHLNGKISNSICDAMRLGEHGFILSTNATISSGYNVN
CDVDCSIRRSSSCTRHARISCISQNGMSSASQCGLRYVEVNARDAAKSRIARVVGGFETV
PGAFPWTAALRNKATKAHHCGASILDKTHLITAAHCFEEDERVSSYEVVVGDWDNNQTDG
NEQIFYLQRIHFYPLYKDIFSHDIAILEIPYPGIEFNEYAQPICLPSKDFVYTPGRQCVV
SGWGSMGLRYAERLQAALIPIINRFDCVNSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGG
PFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAIINGQPV
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgtatatcgtcatagttactatgagaacaatactattttttggaatcttttttattttt
atttttcaatgtgctaaatgtatagaattaaaaattttcgaagatctcttagaagttcgt
agtcaatcaggtctcttcttcccattatgctctaaatcatttcatcaaaaatacggagaa
caagcgtgtgcatcaatttcctctacatttttatcttattccacagtttcacttcaacag
tatacatattcagttggttgtaccacatccgtttgcttcacttttttgtcatctttttgc
aaaactggcgtcaaagtgttttgttcacctagtttatgtgcttctggaactcttcaaatt
ggaagcaaatgtctttcaatttcaactgtccctgttcaaggatactctgaagcaaattat
tattgtaatccagctacattgatatcttctttaaaaccaacagagattgaatcaattcga
gacacaattttgccaacgtttgctgatacacgactatttttgacttccggactccgacag
ggagcaacatggaaatgggggaatggagatacagtagaacaagaagtaacgggaactgga
cgttgtttagctttacaagcaggcaatctcgtggcaattgactgtgattctgaagcatac
gttttttgtgaatctggaagagaatgtattgcgagggacaaagaatattctggaactgca
aacagaacatctgatgggaaaatgtgtcttatgtggaatgacccaacagtattatttcga
agagaaagggatttagagattttgaatcacaatttttgtagatttgtgaatgacgctgat
ggaaaaaaatcagcgacgccagtttgttatacgaaaccaaatgaattatcccaatgttac
attccaccatgtccagaaagttttaatgatgtcgtcccaattgaatctggtgacagttgc
ccaattggttcaatatcatgtgataacggatcgaaatgtatttctgaaaaattccaatgt
gattatgaagttgattgtaacgatggaagtgatgagcataattgtgaagattatcttcaa
tattatgaattgattggtgcatatcggttagctgataacattattgaagtttggactttt
attccacacgtacaagggtgtgctcgaaaatgccgagaaagtcttctaatgtgtgaggct
ttttcatatgaaccaaaaagtcaaacatgtcttctaaccgacacctcacaaacattttcc
agtctagcacggaaaattacttctctgtattaccgaagacgattttctacaaaagacgtt
gaattccaagttgagaacaaagtattatatgcgacaaaatcggccaaaaaaggacatgta
tgtgatgataactacagtcgagaaaagctatcatcaatttgtagagtgctcggatttggg
gacccgatttatactgtggaatcacatcaatccgaatcgtctttgggaccactgcaaccg
acgactttacacccgacgaatccttctttcgattccccttcttcggtttcgcagatgagg
aggaccagcccttccgccacattggctcctcgtctgccggcctggaacttatcatgtttg
agggaaccaaattgtacatctactgtcatttcaacatgtgaaccaatcaggtgctcacat
tgtcagcaagcagcttgtggtgatggatcttgcattcgatttgatcaactttgcaatgga
caaatagattgccaatcaggagaagacgaagattactgtagagcaaactcatttcggttg
accaatggatctgatacaagtggatacctcgaggttctgtttcgatcaagatgggaacca
atttgtgcggatcatcttaacggaaaaatttcaaattctatatgtgacgctatgagacta
ggagagcatggtttcatactgtccaccaatgccacgatttcttctggatataatgttaac
tgtgatgttgactgttctatccgtcgatcatcttcatgtacaaggcatgctagaatatct
tgtatctcacagaatggaatgtcttcagcttctcaatgtggacttcgttacgttgaagtt
aatgctcgtgatgctgcaaaatctcgaattgccagagttgtcggaggctttgaaacagtt
cctggtgcatttccctggacagctgctttgcggaataaagctaccaaagctcatcattgt
ggagcatcgattctagacaagacacatttgatcacagcagcccattgtttcgaagaagac
gaaagagtatcctcgtatgaagttgtagttggtgactgggataacaatcagacagatgga
aatgaacagattttttatttgcagagaattcacttttatccattatataaagacatcttc
tcacatgatattgcaattcttgaaataccgtatcctggaattgaattcaatgaatatgct
cagcctatatgtcttccatcaaaagattttgtgtacacgcctggaagacaatgtgttgta
tctggatggggaagtatgggattgcgttacgcggaacgacttcaagcagctctcattcca
attataaatcgattcgattgtgtgaattcatcccaaatttactcatcaatgtcaagatca
gcattctgtgctggatacctggaaggtggtatagattcttgccaaggtgattccggtggt
ccatttgcgtgtcgacgtgaagatggagcatttgtattggctggagttatcagttggggt
gatggttgtgcacaaaagaaacaaccgggtatttatacaatggtagcaccatatctttca
tggatcagtgcaattattaatggccaacctgtttga

DBGET integrated database retrieval system