KEGG   Caenorhabditis elegans (nematode): CELE_C09B7.1
Entry
CELE_C09B7.1      CDS       T00019                                 

Gene name
ser-7
Definition
(RefSeq) G_PROTEIN_RECEP_F1_2 domain-containing protein
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04020  Calcium signaling pathway
cel04080  Neuroactive ligand-receptor interaction
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    CELE_C09B7.1 (ser-7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    CELE_C09B7.1 (ser-7)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C09B7.1 (ser-7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cel04030]
    CELE_C09B7.1 (ser-7)
G protein-coupled receptors [BR:cel04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    CELE_C09B7.1 (ser-7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 180565
NCBI-ProteinID: NP_741730
WormBase: WBGene00004780
Ensembl: WBGene00004780
UniProt: Q22895
LinkDB
Position
X:join(2673701..2674032,2674730..2674985,2678247..2678576,2680031..2680203,2680812..2680949,2681806..2681844,2682108..2682147)
AA seq 435 aa
MARAVNISPFASYTVVPITSAWPPDDLKADRVQLASFTTGKALLAIAILAMIIMTTVGNA
LVCLAVLLVRKLKHPQNFLLVSLAVADFFVGLVVMPLALIDLLFDKWPLGSTMCSVYTTS
DLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRIMMYIACVWIIAAIVSISSHIIA
NLLNDGTYVDDTGTCQVIPHFIYQSYATIISFYAPTFIMVILNIKIWRAAKRLAAQDRLM
SHCNSVDASERPRNGSAETKDFLNEKETIDVPKKERANSTNSRLFKLERKYLHRPSAFFS
AAKGPLIRQTEKSECKARKTLGVIMSVFIICWLPFFILAIFKSFGMWIPDWLDLLALWLG
YSNSTLNPLIYCKYNKEFRIPFREMLACRCATLQTVMRQQSFTSRYGPPVRYRTQSSSYR
PLLSRRNDSHEASDV
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcccgtgcagtcaacatatctccattcgcttcttatacagtcgtaccaattacctcg
gcatggccaccggacgacttgaaagccgatcgagttcaacttgccagtttcacgactgga
aaagctctgctagccattgccattcttgcaatgattattatgacaacggtcggcaatgcg
ctggtttgcttagcagttttactggtacgaaagttgaaacatcctcaaaattttcttttg
gtctcactggcagtggcggactttttcgtggggctcgttgtgatgccacttgcactgatt
gaccttctcttcgataaatggccacttggaagcaccatgtgttcggtgtacacaacatcc
gacctaacgctatgcactgcttcaattgtgaatctgtgtgcaatatcagttgatagatat
ctggtgatttcaagtccacttcggtattctgcaaaacgaacaactaaacgtatcatgatg
tatattgcctgtgtatggatcatcgctgccattgtgagcatttcgtcgcacattatcgca
aatcttctgaacgacggcacttatgtcgatgacacgggaacttgtcaggtcatccctcat
ttcatctatcaaagctatgctacaattatctcattctatgcgccaacatttatcatggtc
atcttgaacatcaaaatttggcgagcagcaaaacgattggcagctcaagacaggttgatg
tctcactgtaactctgtggatgcctccgaacggccacgaaatggatcagctgagacaaag
gatttcctgaatgagaaagaaacaattgatgttccgaaaaaagagcgggccaattcaaca
aactcgaggcttttcaagttggaacgtaaatatcttcatcgacccagtgcattcttttcg
gctgcaaaaggaccattgattcggcagacggagaaaagtgaatgcaaagcccggaaaaca
ttgggggtcatcatgtcagtgttcattatttgctggctcccattcttcattcttgccata
ttcaagtctttcggcatgtggatcccggattggttggatctgctagcactgtggttaggc
tactcaaatagcacattaaatccattgatctactgcaagtacaacaaagagtttcgaata
ccattccgtgaaatgcttgcttgtcgctgtgctactttacagactgtaatgcgacaacaa
agcttcaccagccgctacggacctcctgttcgctaccgaacccaatcttccagctatcga
ccgcttctatctcgacgcaatgacagtcacgaagcaagtgacgtctag

DBGET integrated database retrieval system