KEGG   Caenorhabditis elegans (nematode): CELE_C09E10.2
Entry
CELE_C09E10.2     CDS       T00019                                 

Gene name
dgk-1
Definition
(RefSeq) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00561  Glycerolipid metabolism
cel00564  Glycerophospholipid metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_C09E10.2 (dgk-1)
   00564 Glycerophospholipid metabolism
    CELE_C09E10.2 (dgk-1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_C09E10.2 (dgk-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C09E10.2 (dgk-1)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CELE_C09E10.2 (dgk-1)
SSDB
Motif
Pfam: DAGK_acc C1_1 DAGK_cat PHD
Other DBs
NCBI-GeneID: 180452
NCBI-ProteinID: NP_001367482
WormBase: WBGene00000958
Ensembl: WBGene00000958
LinkDB
Position
X:complement(join(984635..984838,985192..985290,985338..985421,985827..985973,986020..986145,986190..986522,987240..987649,987701..987848,988933..989051,989487..989640,989686..989817,990314..990402,990456..990638,991079..991235))
AA seq 794 aa
MAAEGHNVDANLVDMRPNHGHYFVKKTFGKPAYCHHCCDKIWGMLTTGYSCEMCNFVCHE
KCLRTVVSYCSSVALQLIKNPVAHTWSAPCLIKRKYCCVCRKRTDDALSVECEVCEYYVH
VDCSDLAVSDCKEAATYVANMESANTVQYHHMREGNLPKESKCIVCRKTCFSTECLAGMR
CEWCGQTAHAVCYRQMDKECDFGVLRKIMLPPMCLTIPRTELPMEQLLNISSHDQPQSLS
SPSKIQADDVSTSGEDVKEREDFEIIRVFDGNNSYRSQDSLRRYHVVRFYVQEKEDPHDH
AVFVGNLPVSLAQRQYERILLKLLGAKEKPFTAIGPIYFEYGSLIITFNTPKAATAAVQK
LQSAIYEEKKLIVLCLPNVQPQMIPKDVEPLLVLVNVKSGGCQGTELIQSFRKLLNPFQV
FDVLNGGPLVGLYVFRNIPKYKILACGGDGTIGWVLQCLDIAKQDAACFSPPCGIVPLGT
GNDLARVLRWGGGYTGEENPMDILKDVIEADTVKLDRWAVVFHEEERNQPTSSGNQTEMN
EQTMNNPEDQTSMIIMNNYFGIGIDADVCLKFHNKRDANPEKFQSRLFNKTQYAKIGLQK
MFFERTCKDLWKRIELEVDGRIIELPNIEGIVVLNLLSWGSGANPWGTSKEEGNFSKPTH
YDGLLEVVGISDVSRLGLIQSKLAAGIRIAQGGSIRITTHEEWPVQVDGEPHIQPPGTIT
ILKSALKAQMLKKAKKSRRGGATNATSLTHPHPETSESMSGPLGVPSTLGDPNHGKTTPD
NTAADSDEEGDAFL
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggcagctgaggggcacaatgttgatgcaaatctggtggacatgcgaccaaatcatggt
cattattttgtgaagaagacgttcggaaagccagcttattgccatcactgttgtgacaaa
atatggggcatgttgacgaccggatacagctgcgaaatgtgcaacttcgtttgtcacgaa
aagtgcctgcgaaccgttgtttcctactgcagcagtgtagcgttgcaactgatcaaaaac
ccggtggcacatacgtggtcggctccctgtttgattaaaaggaagtactgctgcgtttgc
cgaaaacgaaccgatgatgcgttgtccgtcgagtgtgaagtttgcgagtactacgttcat
gttgactgctcggatcttgctgtgtcggattgcaaggaagcggcgacatatgttgcgaat
atggagagtgcaaacactgtccagtaccaccacatgcgcgaaggaaatcttccaaaagaa
tccaagtgcattgtttgccgaaaaacgtgcttctcaacggaatgccttgccggaatgcga
tgtgaatggtgtggtcagacggctcacgcggtttgctatcgacaaatggacaaggaatgt
gactttggagttttacggaaaatcatgctaccaccaatgtgccttacaatacctcgaacc
gagctgccgatggagcaacttctgaatatctcctctcatgatcagccacagtctctatca
tcgccatcaaaaattcaagcggatgacgtctcgacttctggagaagacgtcaaagaacgg
gaagattttgagattattcgagtttttgacgggaacaactcatatcgatcgcaggactcc
ctgcggcgctaccacgttgttcggttttatgtccaagaaaaagaggaccctcatgatcat
gcggtttttgttggaaacctacccgtgtcactcgcacagcgtcaatatgaacgaattctt
ctgaaacttctaggtgctaaagaaaaaccatttactgcaatcgggccgatctactttgaa
tacggtagtttgattatcacattcaacacacccaaggccgccacagcagctgttcaaaag
ctgcaatctgcaatatacgaggaaaagaagctgatagttttatgtctgccaaatgttcaa
ccacagatgattccaaaagacgttgaaccactccttgtgctagttaatgtaaagtcagga
ggttgccaaggaaccgagttaatacaatctttccgcaaactcctcaacccatttcaagtt
tttgatgtgttgaatggaggaccgttggttggattatacgtgtttcgcaacattccaaaa
tacaaaattcttgcatgtggtggagatggaacaattggatgggtactgcaatgtttagat
attgctaaacaggatgctgcttgcttttccccgccgtgtggaatcgttccacttggtact
ggaaacgatttggcaagagttctccggtggggtggtggttataccggagaagaaaatccg
atggatattctcaaggatgtgattgaagccgacactgtgaaactagacagatgggctgta
gtgttccatgaagaagagagaaatcagccgacttcgtctggaaatcaaacggaaatgaac
gaacagacgatgaataatccggaggatcaaacttcaatgattatcatgaacaattatttt
ggaattggaattgatgcagatgtttgcttgaaatttcataacaagagagacgcgaatccg
gaaaaattccaatctcgactatttaacaaaacacaatatgcaaaaattggacttcagaaa
atgttcttcgaaaggacatgtaaagatttatggaaacgtatcgaattagaggttgacggt
cgtataatcgaattgccaaacatcgaagggattgttgtactgaacttgctcagttgggga
agtggtgcaaatccgtggggtacatcgaaggaggagggcaacttttcaaagcctactcat
tatgatggattgctagaggtggtcggaatatccgatgtatcacgcctgggactcatccaa
tccaagctcgccgcgggaattaggatagctcaaggtggaagtatccgaattactacacat
gaagaatggccggttcaagttgacggcgaacctcatatccagccaccgggaactatcaca
atattgaaatcagctttgaaagcacaaatgttgaaaaaagcaaaaaagtcgcgacgcgga
ggcgccacaaatgccacatctctaactcatccgcatccggagacatccgagtcaatgtca
ggaccactcggagtgccatcaacactcggcgacccaaatcatggcaaaacgacgcccgac
aatacagctgcggattctgatgaggaaggcgacgcttttctctga

KEGG   Caenorhabditis elegans (nematode): CELE_F42A9.1
Entry
CELE_F42A9.1      CDS       T00019                                 

Gene name
dgk-4
Definition
(RefSeq) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00561  Glycerolipid metabolism
cel00564  Glycerophospholipid metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_F42A9.1 (dgk-4)
   00564 Glycerophospholipid metabolism
    CELE_F42A9.1 (dgk-4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_F42A9.1 (dgk-4)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F42A9.1 (dgk-4)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CELE_F42A9.1 (dgk-4)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 SAM_1 SAM_2 C1_2 SAM_4 SAM_Ste50p SAM_3 ABC_tran_Xtn
Other DBs
NCBI-GeneID: 177667
NCBI-ProteinID: NP_501476
WormBase: WBGene00006483
Ensembl: WBGene00006483
UniProt: H2KZC9
LinkDB
Position
IV:join(8631433..8631528,8631977..8632036,8632080..8632161,8632208..8632314,8632521..8632619,8632984..8633146,8633434..8633581,8633804..8634075,8634192..8634420,8634478..8634778,8634885..8635407,8635487..8635646,8636180..8636332,8636500..8636851,8637380..8637850,8641785..8641940,8642484..8642670,8642748..8642920,8643030..8643317)
AA seq 1339 aa
MVVTRGLDNDVDDEREAWKQSILRAKDVMPEKASGPLVALLEGTSGHHHWTETNHPRPTF
CNYCREKLNGVPWHGYTCDICKVKAHRKCRDNLTEQCKWTNQSSIPQHLQFISPENSILP
HQWMEGNLPMPSKCSVCEKPCGSVRKLIDYRCIWCGCCVHDTCIGNLARACSLGHSALSV
ISPLAMKEVTPNGTAVLREEAYGGDSPGGSPLIVLINAKSGDSQGQRIIKKFRRILNPIQ
VFDIIATGPDFALTFFSHLESFRVLVCGGDGTVGWVLSAFDRLNLHSKCQLAILPLGTGN
DLARVLGWGHAFYDDTLLPQVVRTMERAHTKMLDRWSVLAIEGPQADAVRRYEELVIEKV
RTFLEAEQTWDIIHAANQLCTTIRDLVHSVSHTYSDLENNKLKLDDESRLGGSDTMTENC
NTLLGKLDRLMKSLKEDANCLEESGFEPGDDDDCSTGDEMLKKRDSVVNRANSLKKAFRE
VISMAEKGIDQHYRDPNTACTKRERFRKKRSKTTPSVLTISHSNLSSSSACSPPCSPAGE
DPPQDDQKEFRSASCKATFEISHSQSSSSAVLTALFNAQSARTYDELEKPSIGTVHPPTP
GATREPSTAYDDDEENENVENRKEIDQKSNSKKSSVSTPEDITKGSPDRPRIYSDTTLNK
NMEKMKSQSLHPICSSADKMKQSHSDSSLYADYEHLEGSSSGCGAGASGSTLSPARASDS
ATWSRIKERKRTVGSDLGLSSSSHLRSCRNMLSGFAGGSLIAEILLLNARVLSQMSSRRN
SAANIANQIPTSDCQTPFTQYKEMCVMNNYFGIGLDAKIALEFHNKREESEKTRSRSKLF
MWYGILGGKELMHRTYRNLEQRIKLECDGVPIDLPSLQGIVILNIPSYSGGANFWGRNKD
GPEFTVQSFDDRILEVVALFGVIHVATSRVPNAVRLQNHRIAQCRHVRIVILGDEPIPVQ
VDGEPWLQPPGIMQIVHKNRAQMLARNPVFDATLKKWEEQKEKASTTTAPSTPTALGAPT
SDIISFLTRAREFLRLIEGEIARLGVSSVLLQSLDDANAIVKGGASGEEDPEAIDDLEER
EETVASVERVVELLEDHFGFPERTRAPVGQPKLGPTPHFNFEIHGDDPDHWRYIINSIRQ
DMDREEAAIREARKQDLIAGKPKRSRFTAWFHKRFGTRSAPFAFANIPYWTSEEVCAWLS
SIGMSEYGSTFRKNDIQGSELMHLERSDIMDIGITKIGHVKRLQSAIVDLRAQNQRARRA
QARKKRVAKDYKPDHSGPSGAGGAVDKRKESSAERYADGQPSTSSTGATTSSGKTRRIPP
KDGESAPAVMQMDPASTDC
NT seq 4020 nt   +upstreamnt  +downstreamnt
atggtggtgacgcgtggattggacaatgatgtcgacgacgaacgagaagcgtggaaacag
tcgattctgcgtgcgaaagatgtcatgccggaaaaggcgtctggaccactcgttgcatta
cttgaaggcacctcgggtcatcatcactggacagagacaaatcatcctcggccaacgttt
tgcaattattgccgcgaaaagttgaacggagtcccatggcacggctatacgtgtgatatc
tgcaaagtgaaagcacatcgaaaatgccgtgacaatttgacggagcaatgcaaatggaca
aatcaatcaagtattccacaacatttacaatttattagcccagagaattcaattctacct
catcaatggatggaaggaaatcttccaatgccatcaaaatgctcagtttgtgaaaagcca
tgtggttccgttagaaaactaatcgactatcgatgtatttggtgtggatgttgtgtccat
gatacgtgtattggaaatctggcacgagcatgtagtttaggtcactcggcactttcagta
atatcaccattagcaatgaaagaagttactccaaatgggacagctgtattacgagaagaa
gcgtacggtggtgattctccaggcggcagtccactaattgtactaatcaacgcgaaatcg
ggtgatagtcagggtcaaagaattatcaaaaaatttcgacggattttgaatccaattcaa
gttttcgatattatcgcaactggtcccgattttgcactaacatttttctcgcatcttgaa
tcatttcgtgtccttgtatgtggtggagatggaactgttggatgggttttaagcgctttt
gatagactgaatttacactcaaagtgtcaattagcaattcttccacttggaactggaaat
gatttggctcgtgtacttggttggggacatgctttttatgatgatacactacttccacaa
gttgttcgaacaatggaaagagcacatacaaaaatgctagatcggtggagtgttctcgct
attgaaggccctcaagcagatgcggttcgtcggtacgaggagctggtcatcgaaaaagtt
cgaacgtttctagaagctgaacaaacatgggacattatacatgcagctaatcaactatgt
acaacgattcgggaccttgttcatagtgtatcacatacgtattctgatttagaaaataac
aagttgaagcttgatgacgagtcaagacttggaggaagtgatacaatgacggaaaattgc
aatactctactgggaaaactcgatcggttgatgaaatcactgaaagaagacgcgaattgt
ttggaggagtctggatttgagcctggtgatgatgatgattgttcaacaggagacgaaatg
ctcaaaaaacgagattctgtagtaaatcgagcgaatagtcttaaaaaggcattccgagaa
gtcatttcaatggccgaaaagggtattgatcaacactatcgagatccgaatacggcgtgt
acgaaaagagagaggttcaggaagaagagaagtaaaactacgcctagcgttcttacgata
tcccattccaacctgtcttcttcatcagcctgttccccaccgtgttcacccgcaggagaa
gatccgccacaagatgatcaaaaagagtttcgtagtgcatcttgtaaagcaacatttgaa
atcagtcattctcaatcaagttcatcagctgttctaacagcactattcaatgcacaatct
gcacgaacctatgatgaattagagaaaccaagtataggaacagtacatccaccaactcct
ggagcaactcgtgagccatcgactgcttatgatgatgatgaggaaaatgaaaatgtcgag
aatcgaaaagaaattgatcaaaaatcgaatagtaaaaagtcttcagtatcaacaccagaa
gatattacaaaaggatcacctgatcggccgaggatctattctgataccacactaaacaaa
aatatggagaaaatgaaaagtcaaagcttgcatcctatttgttcaagtgctgacaagatg
aagcagagtcactcggatagtagcttatatgcagactacgagcatttggaaggttcatca
tctggttgtggtgccggtgcttcaggaagtacattatcgcctgctcgggcttctgattct
gccacctggtcgcgcattaaagaacgtaaacgaactgttggaagtgatttgggattgtct
agtagctctcatttgagaagttgtcgtaacatgctctccggattcgccggtggatctctc
attgctgaaattttactattaaatgcacgagtactgtcacagatgtcgtcacgtcgcaac
tcagcggcaaatattgcaaatcaaattccaacgtccgactgtcaaacaccattcactcaa
tacaaggaaatgtgtgtaatgaacaactattttggaattggtcttgacgcgaaaatcgct
ctggaattccacaacaaacgagaagagtctgaaaaaacgcggagccgatcgaaactcttc
atgtggtacggtattctcggaggaaaagagctgatgcatcgtacctaccgtaatctcgag
caaaggatcaaattggaatgtgatggagttccgatcgatcttccatctcttcagggaatc
gtaattttgaatattccatcatattcgggcggtgcaaacttctggggtcggaacaaggat
ggtccagaattcacagttcaaagtttcgatgatcgaattttggaggtagttgcactgttc
ggcgtgatccacgtggcaacgagtcgtgtcccaaatgcagttcgtctccaaaaccatcga
attgctcaatgtcgacatgttcgaattgtgatactcggagacgaaccaatcccagttcaa
gttgacggtgaaccttggcttcaacctcctggaattatgcaaattgttcacaaaaatcga
gctcagatgcttgccagaaatccagtttttgatgcaacacttaagaaatgggaagaacaa
aaagagaaggcttccacgacaacagcaccatccacacctacggctcttggagctcccact
tcagatattatttcgttcttgacgagagctcgcgaatttttgagattgattgaaggtgaa
atagcgagattaggggtttcatcggtacttttgcaatccttggatgatgcaaatgctatt
gtcaaaggtggagcatcaggagaagaagatccagaggctatcgatgacttagaagaacga
gaagaaacagttgcatcggtggaaagagtcgttgaacttcttgaggatcattttggtttt
cctgaaagaacaagagcaccagttgggcaaccaaaactaggacccactccgcattttaat
tttgaaattcatggtgacgatcctgatcattggcgttatataatcaactcgattcgtcag
gatatggatcgagaagaagcagcaattagagaagctagaaaacaagatttaatagctgga
aagccaaaaagatcccgattcactgcatggtttcacaaacgatttggaactagatctgca
ccatttgcattcgctaatattccatactggacgagcgaagaagtatgtgcatggctctct
tcaattggaatgtctgaatatggatcaacgttccgaaagaatgatattcaaggttctgaa
ttgatgcatttagaacgatccgatattatggatattgggatcacaaaaattggacatgtg
aagaggttgcagtccgccattgtcgacctccgagctcaaaaccaacgtgcacgtcgcgct
caggctcgtaaaaaacgtgtcgccaaagactataaacccgatcattctggtccttctggt
gctggcggtgcagtagataaacgaaaagaatcaagtgctgaaagatatgcagatggacaa
ccatcaacatcatctacgggagctaccacttcatctggaaaaacacggagaattccaccg
aaagatggagaatccgcgcctgctgtcatgcaaatggatccagctagtacagattgctga

KEGG   Caenorhabditis elegans (nematode): CELE_F46H6.2
Entry
CELE_F46H6.2      CDS       T00019                                 

Gene name
dgk-2
Definition
(RefSeq) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00561  Glycerolipid metabolism
cel00564  Glycerophospholipid metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_F46H6.2 (dgk-2)
   00564 Glycerophospholipid metabolism
    CELE_F46H6.2 (dgk-2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_F46H6.2 (dgk-2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F46H6.2 (dgk-2)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CELE_F46H6.2 (dgk-2)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1 NAD_kinase
Other DBs
NCBI-GeneID: 180720
NCBI-ProteinID: NP_001024679
WormBase: WBGene00000959
Ensembl: WBGene00000959
UniProt: H2KYI9
LinkDB
Position
X:complement(join(4495226..4495340,4495393..4495577,4495629..4495800,4496021..4496148,4496256..4496330,4496381..4496470,4496542..4496829,4497237..4497369,4502344..4502432,4502485..4502571,4503644..4503759,4503966..4504098))
AA seq 536 aa
MEMDVYDELLAAALFIVFSSIVLWVFRKLWAVRKRKNINDTSSKSGHYWSSINYSEQHNY
CSGCKEHIVSGYECDNCLLKVDNINCLRAVSTKIQCKVNPIHCRKETFDHHWICGNIGAD
LFCEVCEELCGGVGLQDFRCSWCWRVVHTKCKPKFTKHCDFGGLKRTIIPPYCVTTRRPG
NRNQRMAVIDKIEIPVDIEKWRPIMVIVNPKSGSGAGKQLLRNFRAHLHPAQVVDVLKSN
IAASLRWIDEHPNVDVRILIAGGDGTICSALDQIDTLSRRIPVAVLPLGTGNDLSRLLKW
GKKCDGDIDVIKLMEDIQEAEVTLVDRWTIDAESQKKLGVRLQSNKTLSMTNYVSVGVDA
CVTLGMQNTRESIPRAMSSRLLNKFLFFTFGTKDVFERVCKGLNERIDLYLDDVHVNLPD
IEGLIFLNIPYWGAGVKPWATYNDSHRQECDDEMIEVFAVTSSFHIAQMQIGLASPLCIG
QAKHAKLVFKGNHSFPMQSDGEAWVNSAGTVLISHKCKTAMLRKAEKQTTGCGMFF
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggaaatggacgtgtatgatgaattattggccgctgctttatttatcgttttctcgagc
attgttttgtgggtgtttagaaaattatgggcagtgaggaaacgaaagaatattaatgac
acgtcatctaaaagcggacactactggagttcaatcaattacagtgaacaacacaactat
tgctctggatgcaaagagcacattgtttcgggttacgaatgtgataattgtctgctcaag
gtggataacataaactgtcttcgagcagtatctacaaaaatccaatgtaaagtcaatccg
atacactgtagaaaagagacatttgaccatcattggatatgtggaaacattggcgctgat
ctattttgcgaagtctgcgaagagttgtgcggtggtgttggccttcaagattttcgatgc
tcttggtgttggcgcgttgtgcacaccaagtgtaaaccaaaattcactaaacattgcgat
tttggtggattgaaacgaactatcataccaccatattgtgttaccacaagaagaccagga
aaccggaatcagagaatggctgtcattgacaaaatcgaaataccagttgatattgaaaaa
tggcgcccaatcatggttattgtcaacccaaaaagtggatcaggtgctggaaagcagctt
ctccgcaattttagagctcatttgcacccggcacaagttgtagatgttcttaaatcaaat
attgctgcctcccttcgatggatcgacgaacatcccaatgttgacgtcaggatattgatt
gctggaggtgatggtacaatttgttcagctctcgatcagattgacacacttagccgtcgt
attccggtggccgttttaccgctcggtactggcaacgatctatctcgactattgaaatgg
ggcaaaaaatgcgacggcgatatcgacgtcatcaagttgatggaggatatacaagaagcc
gaggttacgcttgtcgatcgatggacaattgatgcggaaagccagaaaaaactcggagtt
cgattgcagtctaacaaaacgctgtcaatgacaaactacgtgtcggttggtgtcgatgct
tgtgtcacgttaggaatgcaaaacacaagagaatcaattcccagagcaatgagtagcagg
ctactcaacaaattcctcttcttcacatttggaaccaaggatgtttttgagagagtttgc
aagggtctgaacgagagaatcgacctatatttagacgacgtccacgtcaaccttcccgat
atcgaaggtctcatctttctcaacattccatattggggcgctggagtcaagccatgggcc
acgtacaatgatagtcatcgacaagaatgcgacgatgagatgattgaagtgtttgcggtg
acatcatcgtttcatattgctcaaatgcagatcggactggcgagcccgttgtgcattggg
caggccaagcatgcgaagcttgtgttcaaggggaatcactcgttccctatgcaatcggat
ggtgaagcatgggtgaattcggccggaacagtgctaatctcccataagtgcaagactgcg
atgctgaggaaagcggagaagcagacgaccggatgtgggatgttcttctaa

KEGG   Caenorhabditis elegans (nematode): CELE_F54G8.2
Entry
CELE_F54G8.2      CDS       T00019                                 

Gene name
dgk-3
Definition
(RefSeq) Probable diacylglycerol kinase 3
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00561  Glycerolipid metabolism
cel00564  Glycerophospholipid metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_F54G8.2 (dgk-3)
   00564 Glycerophospholipid metabolism
    CELE_F54G8.2 (dgk-3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_F54G8.2 (dgk-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F54G8.2 (dgk-3)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CELE_F54G8.2 (dgk-3)
SSDB
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6
Other DBs
NCBI-GeneID: 186262
NCBI-ProteinID: NP_499031
WormBase: WBGene00000960
Ensembl: WBGene00000960
UniProt: Q03603
LinkDB
Position
III:join(9163077..9163125,9163243..9163325,9164527..9164806,9165046..9165162,9165208..9165332,9165385..9165504,9165717..9165837,9165882..9165962,9166008..9166117,9166355..9167029,9167119..9167274,9167319..9167525,9167568..9167662,9167808..9167908,9167960..9168027)
AA seq 795 aa
MLLSPEQFSRLSEYAAYSRRKLKDMLSDFQQDGKFYSYLSVDGQTINIDGFRAFLIDYFG
ADLPSDLVDQLFLSFSKPPIKERRTSLFEDAISTVRAKFSESLSGRMAGLNIAGGSGQQT
DRSQSSEPQALVCIPEDDVMGPRVANNDSQEPRIPLKPLICTLSLLEADTPENKLDVVFH
VYDSDGNGFLDKSEIDGIIEQMMNVARYQQWDTIELEQVIRQMMVDIDYDNDGIVSFDEW
RRGGLTNIPLLVLLGFDTEMKEDGSHVWRLRHFTKPTYCNACCSILVGWGGKQGLSCSLC
KYTVHERCVRSAATNCIRTYSSRQQDKLYHHWQDANATAKCVKCKATVGVFQGKGCRWCH
NYVHHRCMSALAQECDLGALVHHILPPTHIFPAFLERKTSTSLKNHNFSSHSASLLQAVS
PSNDCRPLLVLVNPKSGGKQGVKILQKFEYLLNPRQVYDLSKTGPEPGLQLFSTLKNCNI
LVCGGDGTIGWVLESMDKMTFPHGRPPVAVLPLGTGNDLARCLRWGGGYENENLHKILEQ
IEKSSLIDMDRWQIKIEITENKSARRASEKGDTPPYSIINNYFSIGVDASIAHRFHVMRE
KFPEKFNSRMRNKLWYFELGTSETLSSSCKNLHEQIDILCDGESIDLGQDASLEGIALLN
IPSIYGGSNLWGRSRKSKGRMPGLFPMKNAEKMQLQTRVQDIGDGLIELVGLESAMQMGQ
IKAGVRGARRLSQCSTVVIQTHKSFPMQIDGEPWMQPPCIIQITHKNQAKMLVAAAPRKR
SSWMLLKRQSTNDDN
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgttgttatcaccggagcaattctcgcggcttagcgaatatgcggcatattctcggcga
aagttgaaagatatgttgagcgattttcagcaagacgggaagttctactcatatctttca
gttgatgggcagactataaatattgatggttttcgtgcgtttcttatcgattactttgga
gcggatcttcccagtgatcttgtggatcaactgttcctttcattctccaagccaccaata
aaagagcggcgaacaagtctattcgaagatgcgatttcaactgtcagagcaaaattcagt
gaatcgttatccggacgaatggctggactgaatattgcaggaggatcaggtcaacaaacg
gataggagtcaaagtagtgaaccgcaagcgcttgtttgcattccagaagatgatgtaatg
gggccaagagttgccaacaatgattcccaggagcctagaattccactgaagcctctaatt
tgcactctttctctacttgaagccgacacacctgaaaacaaactagatgtcgtttttcat
gtctacgattccgatggaaatgggtttctggacaaatctgaaatcgacggaatcattgag
cagatgatgaatgtggcaagatatcaacaatgggatacaattgaactggaacaggttatt
cgccaaatgatggttgacattgattacgataatgatggaattgtatcattcgatgaatgg
agacgaggaggacttacaaatattcctttgctagttcttcttggttttgacacggaaatg
aaagaagatgggtctcatgtttggcgtcttcgtcattttacaaagccaacttactgcaat
gcgtgctgcagtattctagttggatggggtggaaagcaagggctcagttgttcattatgc
aaatacacggttcatgaaagatgtgtcagatcggctgccacaaattgcattcgaacttat
tcaagtagacagcaagacaaactatatcatcactggcaagatgcaaatgcaaccgctaaa
tgtgtcaaatgcaaagcaacagtcggagtttttcaagggaaagggtgtcggtggtgtcat
aattatgttcatcatagatgtatgtctgcacttgctcaagagtgtgatctcggtgcttta
gtccaccatattctcccaccaacgcatatatttcctgcatttctggaacgtaaaacttca
acatcgctgaaaaatcacaacttcagctcccacagtgccagtctccttcaggccgtatct
cctagcaatgattgtcgtcctctcctagttcttgtcaatccgaaaagtggtgggaaacaa
ggagtcaagattctacagaaatttgaatatcttctcaatccaagacaggtctatgatttg
agtaaaactggccctgaaccaggacttcaattattttccactttgaaaaactgtaacatt
ttggtatgtggaggtgatggaacaattggatgggtattggaatcaatggataaaatgaca
tttccacatggaagaccacccgtcgcagttttaccattgggaactggaaatgatttggca
agatgtcttcgatggggtggtggatatgaaaatgagaatttgcataaaatattggaacaa
attgaaaaatcaagtctaattgatatggatcgatggcagattaaaatagaaataacagag
aataaaagtgcaagaagagcaagtgaaaaaggagatacaccaccatacagtatcattaat
aattatttttctattggagtggacgcctcaattgctcaccgattccatgtgatgagagaa
aagtttcctgaaaagttcaatagccggatgcgaaacaagttgtggtactttgagttaggt
acaagtgagaccctatcaagttcttgcaagaacttacacgagcaaattgatattttgtgc
gatggagaatcaatcgatcttggacaagatgcatcacttgaaggaattgctcttttgaat
attccatcaatttacggaggatctaatttatggggaaggagtcgaaaatctaaaggaaga
atgcctgggctgttcccaatgaaaaatgccgagaaaatgcaattacagacaagagttcaa
gatattggagatggtctcattgagttagttggattggagtcagcaatgcaaatgggacag
attaaagcgggtgtacgtggagcaagacggctttctcaatgttcaactgttgtgattcaa
acacacaaatcatttcccatgcaaattgacggggaaccatggatgcaacctccttgcatc
attcaaatcacacacaaaaaccaagcaaaaatgcttgttgctgcagctccacgaaaacga
agctcctggatgcttctcaaacgacagtccacaaatgacgataactga

KEGG   Caenorhabditis elegans (nematode): CELE_K06A1.6
Entry
CELE_K06A1.6      CDS       T00019                                 

Gene name
dgk-5
Definition
(RefSeq) Diacylglycerol kinase
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00561  Glycerolipid metabolism
cel00564  Glycerophospholipid metabolism
cel01100  Metabolic pathways
cel04070  Phosphatidylinositol signaling system
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CELE_K06A1.6 (dgk-5)
   00564 Glycerophospholipid metabolism
    CELE_K06A1.6 (dgk-5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CELE_K06A1.6 (dgk-5)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_K06A1.6 (dgk-5)
Enzymes [BR:cel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CELE_K06A1.6 (dgk-5)
SSDB
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Other DBs
NCBI-GeneID: 174068
NCBI-ProteinID: NP_001355400
WormBase: WBGene00019428
LinkDB
Position
II:complement(join(6456857..6456959,6457009..6457180,6457361..6457492,6457718..6458051,6458109..6458401,6458461..6458609,6458669..6458826,6458927..6459478,6459680..6459961,6460152..6460257,6465528..6465753,6466414..6466548,6467394..6467520,6470110..6470181,6470366..6470462,6471063..6471085))
AA seq 986 aa
MRATVSLLNCCDVPPSHHPSMNGQMLFETCHFLQIPPVPTYRDALTSSCSDLIETVLALH
SNTLSAQEAVSLREAAERRSQFARVPARSVSAPPRKKWFRSKQQLSGAADGMDGSSRAGS
QEIVCDEFTKKLVAAITTWHDIHSSLLQLSIERSSNDSNEEHENVSVSSESSWSSASDSE
SDEDSATGRDSTNNHLSASAARFSISNPDLTNCQIKQMFPEMADHWRKALAKSPVVRRTA
ADQETSNPVNKHRSSRYWIEDEGDYHILPSEHVWLPSSTGSSASADSECYVGEKDCRRSG
EKRRCAACHIVAHTNCFSLLAKLNLNCKTTFRDYATKKTPSKESTDGLTAHHWVHKWRHE
GRCNTCAKSFQQKMFFQGKEKKETIAVTCSWCKESYHLKNCFARDKLEERCNRGALKEMI
VPPTWILRLANRKRSSRTPSHPRKHKKSHRQFVVKPTDLWSSGPSQPLLVFVNPKSGGNK
GSKALHTLCWLLNPRQVFDITSLKGPKFGLEMFRKVVTQLRILVCGGDGTVGWVLSTLDN
LNWPAYPPMAIMPLGTGNDLARCMGWGGVFSDEPISQLMQAILHETIVTHLDRWRIDVEP
NTSCNLEEEDDGMQSALPLTVMTNYFSIGADAHVALQFHHSRSANPQMLNSRLKNRIAYG
GLGTIDLFKRSWKDLCEYITLECDGVDVTPRIKELKLHCILFHNITYYAGGTIPWGESSD
NKPSCCDGKVEVLGFTTATLAALQMGGKGERIAQCSRVRVITNKAIPMQVDGEPCLLAPS
IITLGFHSKVPMLKREKKTPCTPNLMRRGTRYGQKDSQVQSTSLIIQLPVIVVGRADYDN
YKDCFERLKDTAYEIGIVNVESEAELDSARVLIQRLLVEHNSLPYEPDKNWRFLDYVSNA
EEGTFRVSRQQEHVQSVSDVCNTDECLLILDHAFPSITDREAVELFQPQQPIPSTSTSAA
PRYHNSRRISETLRIVLSSDAQETHL
NT seq 2961 nt   +upstreamnt  +downstreamnt
atgagagctacagtttcattattaaactgttgcgatgttcctccatcccatcatccttct
atgaatggacagatgctgttcgaaacttgccattttcttcaaatcccacctgtgcccact
tatcgagatgctctaacatcgtcatgctcggatttaatcgaaactgttttggctctacat
tccaatacgttgagtgctcaagaagctgtttctctccgcgaagcagccgaacgtcgatca
caatttgctcgtgttccagctcgttcagtttctgctccaccgcgaaaaaagtggtttcga
tcgaaacaacaactatcaggcgccgccgatggaatggacggctcatcgcgtgccggctct
caagagattgtatgcgacgaattcacgaagaagctcgttgcggcgattaccacgtggcac
gacattcactcgtctcttctacagttatccatcgagcgctcgtcaaatgattcaaacgaa
gaacatgagaatgtatctgtttcatcagaatcatcatggtcatctgcatctgattctgaa
tcagatgaagattcagcaacaggaagagacagtaccaacaatcacttgtcagcttccgct
gcacgattttcaatttcaaatccagatttgacgaactgtcagattaaacagatgtttcca
gaaatggctgaccattggagaaaagcgttggcaaaatctccggtggtacggcggacagct
gcagatcaagagaccagcaatcctgtgaataagcatagaagtagtaggtattggattgaa
gatgagggagactatcacattcttccatcggaacatgtttggcttccatcatcaactggc
tcatcagcttctgcagattcagaatgttatgttggtgaaaaagattgtcgacgttcggga
gagaaacgaagatgtgctgcatgtcatattgttgctcacaccaattgcttttcattgctc
gcaaaactcaatttgaactgtaaaacaactttccgagattatgcaacaaagaagactcct
tcgaaagagagtactgatggattaaccgctcatcattgggttcataagtggcgccatgaa
ggaagatgcaacacttgtgcaaaatcgttccaacaaaaaatgtttttccaagggaaagaa
aagaaagaaacaattgcggtgacatgttcatggtgcaaagaatcatatcatttgaaaaac
tgttttgcacgtgacaaattggaagagagatgtaacagaggagctctcaaggaaatgatt
gttccacccacgtggattcttcgtcttgcaaaccgtaaacgaagtagtcgaacaccatca
catccgagaaaacacaaaaaatctcatcgacaattcgtggtgaaaccgacagatttatgg
tcaagcggaccgtcccagccacttttggtttttgtaaatccgaaatcgggaggaaataaa
ggatcgaaagcattacatactctttgttggcttttaaatcctcgacaagtttttgatata
acctcactaaaaggacctaaatttggattggaaatgttccggaaagttgtgacacaattg
agaattctggtttgtggaggtgatggaactgttggatgggtgctatcaacactagataat
ctgaattggccggcatatccaccaatggcaattatgcctcttggtacgggaaatgatttg
gcgagatgtatgggatggggaggtgttttctcggatgagccaatcagtcaactcatgcaa
gcgattcttcatgaaactattgttacacatttagataggtggcgaattgatgtggagccg
aacacttcttgtaatttggaagaggaagatgatggaatgcagtcagcacttccattaact
gtaatgaccaattatttttcgattggagcagatgcacatgttgcattacaattccatcat
tcgagaagtgcaaatccacaaatgttgaactctcgcctgaaaaatcgaattgcatatgga
ggcctaggaactattgatttgttcaaaagatcatggaaagatctttgtgaatatatcact
ttggaatgtgacggagttgatgttactccgagaatcaaagaattgaaacttcattgcatt
ctatttcataatatcacttactatgccggtggaacaatcccatggggtgaatcttctgat
aataaacctagttgctgtgatggaaaagttgaagttcttgggtttactactgctacattg
gctgctctacaaatgggtggaaaaggagaacgtattgcacaatgttcaagagttcgagtt
attacaaataaagcaattccaatgcaagtcgatggagaaccatgtcttcttgctccttct
ataatcacgttgggatttcacagtaaggttccaatgttgaaacgggaaaagaagacgcca
tgcactccaaatttgatgagacgaggaacgagatatggacaaaaagattcacaagttcaa
tcaacatcactaataattcaattgccagtaattgtggttggaagagctgattacgataat
tataaggattgttttgaacgattaaaagatactgcttacgaaattggaatcgtgaatgtt
gaatcagaagccgaacttgattcggcaagagttctcattcagagacttctcgttgagcac
aactcccttccctatgagcctgacaagaattggagatttttggattatgtttcaaatgca
gaagaaggaacatttcgagtttctcgtcaacaagaacatgtacaaagtgttagtgatgtg
tgtaatacagatgaatgtcttttgattcttgatcatgcttttccttcaataactgatcgg
gaagcggtcgagttatttcaaccacaacaacctattccatctacttcaacaagtgccgct
ccccgttaccataactcccgccgaatatctgagactcttcgaattgttttgagctctgac
gctcaagaaactcatttgtag

DBGET integrated database retrieval system