KEGG   Caenorhabditis elegans (nematode): CELE_C12C8.3
Entry
CELE_C12C8.3      CDS       T00019                                 

Gene name
lin-41
Definition
(RefSeq) Protein lin-41
  KO
K12035  tripartite motif-containing protein 71 [EC:2.3.2.27]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C12C8.3 (lin-41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_C12C8.3 (lin-41)
   04121 Ubiquitin system [BR:cel04121]
    CELE_C12C8.3 (lin-41)
Enzymes [BR:cel01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     CELE_C12C8.3 (lin-41)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_C12C8.3 (lin-41)
Ubiquitin system [BR:cel04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    CELE_C12C8.3 (lin-41)
SSDB
Motif
Pfam: NHL DUF5128 SGL Filamin zf-B_box PQQ DUF4934
Other DBs
NCBI-GeneID: 172760
NCBI-ProteinID: NP_001020999
WormBase: WBGene00003026
Ensembl: WBGene00003026
UniProt: Q9U489
LinkDB
Structure
PDB: 
4UMG

Position
I:complement(join(9335965..9336126,9336173..9336443,9336491..9337168,9337214..9337426,9337787..9338158,9338208..9338287,9338503..9338804,9338856..9338952,9340020..9340143,9340198..9340469,9340857..9341128,9341176..9341316,9341360..9341409,9341453..9341714,9341762..9341897))
AA seq 1143 aa
MATIVPCSLEKEEGAPSGPRRLQTEIDVDANDSGNELSMGGSSSEGDSMSHHRGEHSPNH
HHQDNHLGSGPPPPQFTGSLFDTPPSMIQSPQQQPQFQFNTGFGLGLPQDSFRCSVCSKS
STIGVLPFVCAHKTCQSCYQMTPSSYDRRACKLCGAVSTATANFTSQMYLSPTLPSPPRG
ALMSDCSTPTMNNHINSSTPLHQPRAFSFSLSGMPGSPSPVMGARMPSSAGGLMMRPIGF
PDSDSSLTSWSPLQQPSQLSINNLSSIGGHQQQSPMLMQNVFDSLAVNDDTPVFSPLSPT
NTSMHMPPSLMASPDVPKHSATIAPPRNSMCSTPRLQLATPMSSQSQQTFPIPSPLGSQP
QQQQPMGPIQCQGCESKISFAYCMQCQEALCIHCVQAHQRVRATKQHAFVELQQLMATLM
SRAVQPQQAQQYTQNVGGSVRQALGSVGSGDGHVSGVENDSIGSGESSPRSSSVCGTHDS
VIIGICENCPHSVLLCAICVAQHPGKHRVQPLGDIRVAVGEVVNESQLLQWQCEKTGDTI
KQIIDGIVTNATTAENEIRAAFDTHVNALEERRKELLKRVETVKNLKLSVLISQAESLQS
KQIDLQQAIQTATKLMDSSDCDEMVLRQVFEKLASCQMGNEGTEPNNNILNVLMLACQVN
EDDRLKFTAPQDGILLNKARQFGNIESGPCAKNSSIVGDSFKKAIRERQTVIYVQLRDAC
GDLLSSSIAATQPTSQALLPHQEPHSHLEQAMPTSDVQAFVISPDGSTVEVTMTPRENGI
VALSYYPSIEGSYTLNILVKGTPISGCPTTMDIRRGRNYDEIAAKGPILTFGKEGSGDGE
LCRPWGICVDQRGRVIVADRSNNRVQIFDKDGNFISKFGTSGNRPGQFDRPAGITTNSLN
NIVVADKDNHRVQVFDENGMFLLKFGDRGRAVGYFNYPWGVATNSHNAIAVSDTRNHRVQ
IFTPQGQFVRKCGFDSAYFFKNLDSPRGLCYLPDGQLLITDFNNHRLAVLSPRNMSEMKV
YGSEGDGDGMFVRPQGVVIDPEGHILVCDSRNNRVQVFASDDMRFIGSFGLGPVPNSGFQ
MPQELPAPYSSLGGPFGAPAFSSAPTPLTPSPRQLLDRPTDLAVGPDGRIYVVDFGNNCI
RVF
NT seq 3432 nt   +upstreamnt  +downstreamnt
atggcgaccatcgtgccatgctcattggagaaagaagaaggagcaccatcaggacctcgt
cggcttcaaactgagatcgacgtggacgccaacgacagcggaaacgagctgtcgatgggc
ggaagcagcagtgaaggtgactcaatgtcccaccatcgcggtgagcattcaccaaaccat
catcatcaggataatcatcttggctcgggaccaccaccaccacagttcactggctcacta
tttgacactccaccgtcaatgattcagtcaccacagcagcaaccacagttccagttcaac
actggattcggactcggactcccgcaagactcctttcggtgctcagtctgctccaagagc
tcgacgattggagtgctgccgttcgtttgtgcgcacaaaacgtgccaatcatgctaccag
atgacaccgtcctcgtacgatcgacgggcttgcaagctgtgtggtgccgtatcgacagcc
accgccaactttacatcgcagatgtacctgtctccgacgcttccatcaccgccacgtgga
gctctgatgtcggattgttcgacaccaacgatgaataatcacattaattcatcaactcca
cttcatcaacctcgtgcattctcattctcactcagtggaatgcctggatcaccgtctcca
gtgatgggtgcacggatgccatcgtctgctggtgggctcatgatgcgtccaattggattc
cccgactcggacagcagtttgacatcatggtctccattgcaacaaccatcacagctttct
atcaataatctgtcgagcatcggaggacaccagcaacaatcgccgatgttgatgcaaaat
gtgtttgattcgttggcagtgaacgatgatactcctgtattctctccactctctccaacg
aatacttcaatgcatatgccaccatcattgatggcatcaccagatgttccaaaacattct
gcaaccatagctccaccacgtaattccatgtgctcgacgccacgtcttcaattggcaaca
ccaatgtcttcacaatcacagcaaacttttccaattccttcaccacttggatctcagcca
caacaacaacagccaatgggtccgattcaatgtcaaggatgcgaatcgaaaatatcgttc
gcctactgtatgcaatgtcaggaagctttgtgtattcattgtgttcaagctcatcagcgt
gttcgagccaccaaacaacatgcgttcgttgagcttcagcagttgatggctactttgatg
agccgtgcagttcaaccacaacaagcacagcaatacactcaaaatgttggaggatcagtt
cgtcaagcacttggatcagttggaagtggagatggacatgtgtctggcgttgaaaatgat
tcaattggcagtggagaatcatcacctcgaagctcttctgtgtgtggaactcatgattca
gtaatcattggaatctgtgagaattgtcctcattcagttctattgtgtgcaatctgtgtt
gctcaacatcctggaaagcatcgagttcagccacttggagatattcgagttgctgttgga
gaagttgttaatgagagtcaattattgcaatggcaatgtgagaagactggtgatactatc
aagcagattatcgatggaattgttacaaatgcaacgaccgctgaaaacgagattcgagcc
gctttcgatacacacgtcaacgctttggaggaacgacgaaaggaactactcaagagggtg
gagacagtgaagaatctgaaactgtcagttctcatttcacaagcagaaagtcttcaatca
aagcaaattgatttacaacaagcaattcaaactgcaacaaagttgatggatagttctgat
tgtgatgagatggttcttcgtcaagtatttgaaaagttggcatcgtgccaaatgggaaat
gagggcaccgagccaaacaacaatattttgaatgtattgatgttggcatgtcaggtgaat
gaagacgatcgactcaaattcacagctccacaggatggaattcttcttaacaaagctcga
caattcggaaatattgagagtgggccatgtgccaagaatagttcaattgtcggagactct
tttaaaaaagcgattcgtgagcgtcaaacagtgatctatgtgcaactccgcgatgcatgt
ggagatctgttgtcttcatcgattgctgcaactcaaccaacatcccaagcacttcttcct
catcaagaaccacattcccatttggaacaagctatgccaacttctgatgtacaggctttt
gtcatttcaccagatggatcaactgtagaggtcacaatgacaccccgtgagaatggaatc
gtcgcactctcgtattatccatctatcgaaggatcctacacactgaatattcttgtcaaa
ggaactccaatcagtggatgcccgacaacaatggatattcgacgtggcaggaactatgat
gagattgcagcaaaagggccaattctgacattcggaaaagaaggatccggtgacggagaa
ttatgtcgtccatggggaatatgtgttgatcagagaggacgtgttattgtcgctgatcga
agcaacaatcgtgttcaaatatttgacaaagatggaaatttcatctcaaagttcggaacc
agtggaaatcgtccaggacagtttgatcgtcctgctggaataactaccaattctctgaac
aatattgtggtggctgataaagataatcatcgtgtccaggtattcgatgaaaacggaatg
ttccttctcaagtttggagatcgtggacgtgctgttggctacttcaactatccatgggga
gttgccacgaattctcataatgcgatagccgtctcggatactcggaatcatcgtgttcag
atcttcacaccacagggacaattcgttcgcaaatgtggatttgactccgcctacttcttc
aagaacttggactcgccacgtggattgtgctatctgccagatggacaattactcattacc
gacttcaacaatcaccgactcgcagtcctatcgcccagaaacatgtcagagatgaaggtt
tacggaagtgaaggagatggtgatggaatgttcgttcgtccacaaggagttgtgattgat
ccagagggacatatacttgtatgtgactctcggaacaatcgagttcaagtctttgcgtct
gatgatatgagattcattggctcatttggacttggacccgtccccaattctgggttccaa
atgccacaagagctaccggctccgtattcgtctctcggtggtccattcggtgctccagcc
ttttcatcggctccaactccactgactccttcaccacgtcagcttctggatcgtcccact
gatttggcagttggacctgatggtcgcatatacgtcgttgatttcggaaacaattgcatc
cgtgtcttctag

DBGET integrated database retrieval system