KEGG   Caenorhabditis elegans (nematode): CELE_C15F1.7Help
Entry
CELE_C15F1.7      CDS       T00019                                 

Gene name
sod-1
Definition
(RefSeq) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04146  Peroxisome
cel04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    CELE_C15F1.7 (sod-1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    CELE_C15F1.7 (sod-1)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CELE_C15F1.7 (sod-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 174141
NCBI-ProteinID: NP_001021956
WormBase: WBGene00004930
UniProt: P34697
LinkDB All DBs
Structure
PDB: 

Position
II:complement(join(6972876..6972973,6973018..6973171,6973216..6973374,6973418..6973501,6973833..6973880))
Genome map
AA seq 180 aa AA seqDB search
MFMNLLTQVSNAIFPQVEAAQKMSNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGL
TPGLHGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIK
LTDTLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAPQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaatcttctcactcaggtctccaacgcgatttttccgcaggtcgaagccgct
caaaaaatgtcgaaccgtgctgtcgctgttcttcgtggagaaactgttaccggtactatc
tggatcacacagaagtccgaaaatgaccaggcagttattgaaggagaaatcaagggactt
actcccggtcttcatggattccacgttcaccaatatggtgattccaccaacggatgcatt
tctgccggtccacacttcaatccatttggaaagactcatggtggaccaaaatccgagatc
cgtcacgtaggcgatctaggaaatgtggaagctggagccgatggagtggcaaaaatcaag
ctcaccgacacgctcgtcacgctttacggtccaaacactgtcgttggccgatctatggtt
gttcatgccggacaagacgacctcggcgagggagtcggagacaaggcagaagagtccaag
aagactggaaacgccggagctcgtgctgcctgcggtgtcattgctctcgctgctccccag
tga

DBGET integrated database retrieval system