KEGG   Caenorhabditis elegans (nematode): CELE_C18E3.8
Entry
CELE_C18E3.8      CDS       T00019                                 

Gene name
hop-1
Definition
(RefSeq) Presenilin hop-1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04310  Wnt signaling pathway
cel04330  Notch signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_C18E3.8 (hop-1)
   04330 Notch signaling pathway
    CELE_C18E3.8 (hop-1)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C18E3.8 (hop-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_C18E3.8 (hop-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     CELE_C18E3.8 (hop-1)
Peptidases and inhibitors [BR:cel01002]
 Aspartic peptidases
  Family A22: presenilin family
   CELE_C18E3.8 (hop-1)
SSDB
Motif
Pfam: Presenilin GAPT
Other DBs
NCBI-GeneID: 172017
NCBI-ProteinID: NP_491328
WormBase: WBGene00001985
Ensembl: WBGene00001985
UniProt: O02100
LinkDB
Position
I:complement(join(4208592..4208795,4209137..4209222,4209272..4209415,4209597..4209984,4210036..4210159,4210210..4210340))
AA seq 358 aa
MPRTKRVYSGKTITGVLYPVAICMLFVAINVKLSQPEQQEQSKVVYGLFHSYDTADSGTI
TLYLIGFLILTTSLGVFCYQMKFYKAIKVYVLANSIGILLVYSVFHFQRIAEAQSIPVSV
PTFFFLILQFGGLGITCLHWKSHRRLHQFYLIMLAGLTAIFILNILPDWTVWMALTAISF
WDIVAVLTPCGPLKMLVETANRRGDDKFPAILYNSSSYVNEVDSPDTTRSNSTPLTEFNN
SSSSRLLESDSLLRPPVIPRQIREVREVEGTIRLGMGDFVFYSLMLGNTVQTCPLPTVVA
CFVSNLVGLTITLPIVTLSQTALPALPFPLAIAAIFYFSSHIALTPFTDLCTSQLILI
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgccaagaacaaaaagagtgtactccgggaaaaccataacaggagttctctatcctgtt
gcaatttgcatgttgttcgtcgcgataaatgtgaaactcagccagccagaacaacaagaa
caatctaaagtagtatacggactgttccattcatacgataccgcggatagcgggacaatc
actttgtatttgattggatttttgattttgacgactagtttgggagttttttgttatcag
atgaagttttataaggccataaaagtatacgtattagccaacagcattggaattctgctg
gtttactcagttttccatttccaaagaatagctgaagcccaatcaattccagtatctgta
ccaacatttttcttccttattctccaattcggtggtcttggaataacatgtctccactgg
aaatcccatcgacgacttcatcaattttatcttattatgctcgcaggtctaactgcaatt
tttattctcaatattcttcccgactggactgtttggatggcattaacagcgatttcattt
tgggatattgttgctgttctgacaccgtgtggaccattaaaaatgctcgtggaaactgcg
aatcgacgcggagacgacaaatttccagctattttatacaattcaagttcatacgtgaat
gaagtggattcccctgacacaacacgatcaaacagtaccccgctaactgaattcaacaat
tcatcgagttcaaggcttttggaatctgattcacttttgaggcctccagtgattcccaga
cagattagagaagtacgagaagttgaaggaacaattcggttaggaatgggagattttgta
ttttattcactgatgttgggaaatactgttcaaacgtgcccacttccaactgtcgtcgcg
tgcttcgtatccaatcttgttggtttgacaattactctgccaattgtcacattatctcaa
actgcacttccagcattgccgttcccgttggcaattgcagcaatattctacttctcctcc
catatcgcattaaccccattcaccgatctgtgcacctcacagctaattttaatttaa

KEGG   Caenorhabditis elegans (nematode): CELE_F35H12.3
Entry
CELE_F35H12.3     CDS       T00019                                 

Gene name
sel-12
Definition
(RefSeq) Presenilin sel-12
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04310  Wnt signaling pathway
cel04330  Notch signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_F35H12.3 (sel-12)
   04330 Notch signaling pathway
    CELE_F35H12.3 (sel-12)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F35H12.3 (sel-12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_F35H12.3 (sel-12)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     CELE_F35H12.3 (sel-12)
Peptidases and inhibitors [BR:cel01002]
 Aspartic peptidases
  Family A22: presenilin family
   CELE_F35H12.3 (sel-12)
SSDB
Motif
Pfam: Presenilin DUF3377
Other DBs
NCBI-GeneID: 180441
NCBI-ProteinID: NP_508175
WormBase: WBGene00004769
Ensembl: WBGene00004769
UniProt: P52166
LinkDB
Position
X:join(915874..915927,915998..916188,916493..916702,916748..917067,917129..917212,917262..917468,917891..918159)
AA seq 444 aa
MPSTRRQQEGGGADAETHTVYGTNLITNRNSQEDENVVEEAELKYGASHVIHLFVPVSLC
MALVVFTMNTITFYSQNNGRHLLYTPFVRETDSIVEKGLMSLGNALVMLCVVVLMTVLLI
VFYKYKFYKLIHGWLIVSSFLLLFLFTTIYVQEVLKSFDVSPSALLVLFGLGNYGVLGMM
CIHWKGPLRLQQFYLITMSALMALVFIKYLPEWTVWFVLFVISVWDLVAVLTPKGPLRYL
VETAQERNEPIFPALIYSSGVIYPYVLVTAVENTTDPREPTSSDSNTSTAFPGEASCSSE
TPKRPKVKRIPQKVQIESNTTASTTQNSGVRVERELAAERPTVQDANFHRHEEEERGVKL
GLGDFIFYSVLLGKASSYFDWNTTIACYVAILIGLCFTLVLLAVFKRALPALPISIFSGL
IFYFCTRWIITPFVTQVSQKCLLY
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgccttccacaaggagacaacaggagggcggaggtgcagatgcggaaacacataccgtt
tacggtacaaatctgataacaaatcggaatagccaagaagacgaaaatgttgtggaagaa
gcggagctgaaatacggagcatctcacgttattcatctatttgtgccggtgtcactatgc
atggctctggttgtttttacgatgaacacgattacgttttatagtcaaaacaatggaagg
catttactatacactccttttgtccgggaaacagacagtatcgttgagaagggattgatg
tcacttggaaatgctctcgtcatgttgtgcgtggtcgttctgatgacagttctgctgatt
gttttctataaatacaagttttataagcttattcatggatggcttattgtcagcagtttt
cttcttcttttcctattcactacaatctatgtgcaagaagttctgaaaagtttcgatgtg
tctcccagcgcactattggttttgtttggactgggtaactatggagttctcggaatgatg
tgtatacattggaaaggtccattgcgtctgcaacagttctaccttattacaatgtctgca
ctaatggctctggtctttatcaagtacctaccagaatggactgtgtggtttgtgctgttt
gttatctcggtttgggatctggttgccgtgctcacaccaaaaggaccattgagatatttg
gtggaaactgcacaggagagaaacgagccaattttcccggcgctgatttattcgtctgga
gtcatctatccctacgttcttgttactgcagttgaaaacacgacagacccccgtgaaccg
acgtcgtcagactcaaatacttctacagcttttcctggagaggcgagttgttcatctgaa
acgccaaaacggccaaaagtgaaacgaattcctcaaaaagtgcaaatcgaatcgaatact
acagcttcaacgacacaaaactctggagtaagggtggaacgggagctagctgctgagaga
ccaactgtacaagacgccaattttcacaggcacgaagaggaagagagaggtgtgaaactt
ggtctgggcgacttcattttctactctgttctcctcggcaaggcttcatcgtactttgac
tggaacacgactatcgcttgttatgtggccattcttatcggtctctgcttcactcttgtc
ctgctcgccgtcttcaaacgagcactcccggctctgccaatttccattttctccggactc
attttttacttttgtacccgctggatcatcaccccatttgttacacaagtctctcaaaag
tgtttattatattaa

KEGG   Caenorhabditis elegans (nematode): CELE_ZK524.1
Entry
CELE_ZK524.1      CDS       T00019                                 

Gene name
spe-4
Definition
(RefSeq) Presenilin spe-4
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04310  Wnt signaling pathway
cel04330  Notch signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    CELE_ZK524.1 (spe-4)
   04330 Notch signaling pathway
    CELE_ZK524.1 (spe-4)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_ZK524.1 (spe-4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_ZK524.1 (spe-4)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     CELE_ZK524.1 (spe-4)
Peptidases and inhibitors [BR:cel01002]
 Aspartic peptidases
  Family A22: presenilin family
   CELE_ZK524.1 (spe-4)
SSDB
Motif
Pfam: Presenilin Latexin
Other DBs
NCBI-GeneID: 172498
NCBI-ProteinID: NP_492095
WormBase: WBGene00004958
Ensembl: WBGene00004958
UniProt: Q01608
LinkDB
Position
I:join(7454714..7454920,7455303..7455557,7455601..7455736,7455784..7455857,7455905..7456130,7456202..7456459,7456524..7456670,7456720..7456814)
AA seq 465 aa
MDTLRSISSELVRSSQLRWTLFSVIANMSLTLSIWIGVYNMEVNSELSKTYFLDPSFEQT
TGNLLLDGFINGVGTILVLGCVSFIMLAFVLFDFRRIVKAWLTLSCLLILFGVSAQTLHD
MFSQVFDQDDNNQYYMTIVLIVVPTVVYGFGGIYAFFSNSSLILHQIFVVTNCSLISVFY
LRVFPSKTTWFVLWIVLFWDLFAVLAPMGPLKKVQEKASDYSKCVLNLIMFSANEKRLTA
GSNQEETNEGEESTIRRTVKQTIEYYTKREAQDDEFYQKIRQRRAAINPDSVPTEHSPLV
EAEPSPIELKEKNSTEELSDDESDTSETSSGSSNLSSSDSSTTVSTSDISTAEECDQKEW
DDLVSNSLPNNDKRPATAADALNDGEVLRLGFGDFVFYSLLIGQAAASGCPFAVISAALG
ILFGLVVTLTVFSTEESTTPALPLPVICGTFCYFSSMFFWEQLYG
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggacacccttcgatcgatttctagcgaattagtgcgatcttcacaattacgatggaca
ctgttctctgttattgccaatatgtcactgacattgtctatttggattggagtttacaac
atggaagtgaattctgaattgagcaagacttattttttggatccttcgtttgagcaaaca
actggaaatttgctgttggatggatttatcaatggagttggtacaattctcgttcttgga
tgcgtctctttcataatgctcgctttcgtactctttgatttccgtcgtatcgtaaaagcc
tggctcacactttcatgtcttttgatattgtttggggtatccgcgcagactcttcatgat
atgttttcacaagtatttgaccaagatgacaacaatcaatattacatgacaattgtgttg
atagtggttccaacggttgtatatgggttcggagggatctatgcattcttctctaacagt
tctttgattcttcatcaaatattcgttgtcacaaactgttctcttatctccgttttctac
ctacgagtttttccaagcaaaaccacttggtttgttctctggattgttctattttgggat
ctctttgccgttttagcaccgatgggtccactcaaaaaagttcaagaaaaggcttcagac
tacagtaaatgcgttctcaatttaattatgttttctgctaatgaaaaacgtttaactgca
ggatccaatcaagaagagacaaatgaaggagaggagagtacaatcagaagaaccgtgaag
caaacgattgaatattatacaaaacgtgaagctcaagatgatgaattttatcaaaagatc
agacaacgtcgggctgcaatcaatccagattcggtaccaactgagcatagcccattagta
gaagccgagccatcaccaatcgaattaaaggaaaagaacagtaccgaggagctcagtgat
gatgagagtgatacatctgaaacttcaagtggatcatctaatttatcgtcttccgactca
agcaccactgtgtcaacatctgatataagcactgctgaggaatgtgatcagaaggagtgg
gatgatttggtctctaacagtctaccgaacaatgataaacggccagccactgctgcggac
gcccttaatgatggagaagtacttcgtctcggctttggagatttcgtcttctacagtctt
ctgattggtcaagcggctgccagcggatgtccatttgcagtcatttctgccgctcttggt
attttatttggacttgttgtgactctcactgtcttttcaactgaggaatccacaactcct
gctctgccgttgcctgtgatttgtggtactttctgctatttcagttcaatgtttttctgg
gagcaactttacggatga

DBGET integrated database retrieval system