KEGG   Caenorhabditis elegans (nematode): CELE_C25B8.3Help
Entry
CELE_C25B8.3      CDS       T00019                                 

Gene name
cpr-6
Definition
(RefSeq) Cathepsin B-like cysteine proteinase 6
  KO
K01363  cathepsin B [EC:3.4.22.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04140  Autophagy - animal
cel04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    CELE_C25B8.3 (cpr-6)
   04140 Autophagy - animal
    CELE_C25B8.3 (cpr-6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_C25B8.3 (cpr-6)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cel03110]
    CELE_C25B8.3 (cpr-6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C25B8.3 (cpr-6)
   00536 Glycosaminoglycan binding proteins [BR:cel00536]
    CELE_C25B8.3 (cpr-6)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.1  cathepsin B
     CELE_C25B8.3 (cpr-6)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C1: papain family
   CELE_C25B8.3 (cpr-6)
Chaperones and folding catalysts [BR:cel03110]
 Intramolecular chaperones
  Papain family
   CELE_C25B8.3 (cpr-6)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   CELE_C25B8.3 (cpr-6)
Glycosaminoglycan binding proteins [BR:cel00536]
 Heparan sulfate / Haparin
  Others
   CELE_C25B8.3 (cpr-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C1 Propeptide_C1 Peptidase_C1_2
Motif
Other DBs
NCBI-GeneID: 180931
NCBI-ProteinID: NP_741818
WormBase: WBGene00000786
Ensembl: WBGene00000786
UniProt: P43510
LinkDB All DBs
Position
X:join(6607252..6607254,6607304..6607379,6607427..6607521,6607565..6607660,6607854..6608195,6608250..6608522,6608570..6608787,6608934..6608970)
Genome map
AA seq 379 aa AA seqDB search
MKTLLFLSCIVVAAYCACNDNLESVLDKYRNREIDSEAAELDGDDLIDYVNENQNLWTAK
KQRRFSSVYGENDKAKWGLMGVNHVRLSVKGKQHLSKTKDLDLDIPESFDSRDNWPKCDS
IKVIRDQSSCGSCWAFGAVEAMSDRICIASHGELQVTLSADDLLSCCKSCGFGCNGGDPL
AAWRYWVKDGIVTGSNYTANNGCKPYPFPPCEHHSKKTHFDPCPHDLYPTPKCEKKCVSD
YTDKTYSEDKFFGASAYGVKDDVEAIQKELMTHGPLEIAFEVYEDFLNYDGGVYVHTGGK
LGGGHAVKLIGWGIDDGIPYWTVANSWNTDWGEDGFFRILRGVDECGIESGVVGGIPKLN
SLTSRLHRHHRRHVYDDNY
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttgctcttcctttcctgcatagtggtagcagcttattgcgcatgcaatgat
aaccttgagtccgttttggacaaatatcgcaatcgtgaaattgactcagaagcagctgag
cttgacggagatgacttgatcgactatgtcaatgaaaaccaaaatctttggacggctaag
aaacaaagacgtttttcatcggtctacggagagaacgacaaggcgaaatggggattgatg
ggtgtcaaccatgtcagactttctgttaagggcaaacaacacttgtccaagaccaaggat
ctcgatttggacattccagaaagctttgattctcgtgacaattggccaaaatgcgattcc
atcaaggtcatcagagaccagtcaagctgtggatcctgctgggctttcggagccgttgag
gcaatgtctgatcgtatttgcattgcttcccatggagaacttcaagttacactttccgct
gatgatcttctcagttgctgcaaaagctgtggattcggatgtaacggaggagatccattg
gctgcctggcgctactgggtgaaggatggaatcgttactggatcaaactacaccgctaac
aatgggtgcaagccatacccattcccaccatgtgagcatcactcgaagaaaacccacttc
gatccatgtccacacgatttgtacccaactccaaaatgtgaaaagaagtgcgtttctgat
tacactgacaagacttactccgaggacaaattctttggcgccagcgcgtacggagtcaag
gatgacgttgaagccatccagaaagaattgatgactcacggaccccttgagatcgctttc
gaggtttacgaggatttcttgaactatgacggtggagtctatgttcacaccggaggaaag
ctcggaggaggacacgccgtcaagcttatcggatggggtattgacgatggaatcccatac
tggacagttgccaactcttggaacaccgactggggagaggatggattcttccgtatcctg
agaggagttgatgagtgtggaattgaatctggagttgttggaggaattccaaagctcaat
agtcttacctcaagacttcacagacaccaccgccgccacgtctacgatgacaactactga

DBGET integrated database retrieval system