KEGG   Caenorhabditis elegans (nematode): CELE_C26C6.2
Entry
CELE_C26C6.2      CDS       T00019                                 

Gene name
goa-1
Definition
(RefSeq) Guanine nucleotide-binding protein G(o) subunit alpha
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C26C6.2 (goa-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C26C6.2 (goa-1)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_C26C6.2 (goa-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C26C6.2 (goa-1)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_C26C6.2 (goa-1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc Ras TniB AAA_29
Other DBs
NCBI-GeneID: 172505
NCBI-ProteinID: NP_492108
WormBase: WBGene00001648
Ensembl: WBGene00001648
UniProt: P51875
LinkDB
Position
I:join(7522210..7522370,7522671..7522812,7524032..7524192,7524397..7524525,7524574..7524703,7525039..7525192,7525245..7525318,7525742..7525855)
AA seq 354 aa
MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESG
FTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPF
SEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRV
KTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDET
TNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEA
SAYIQAQFEAKNKSANKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggttgtaccatgtcacaggaagagcgtgccgctcttgaaagatcacgaatgattgag
aaaaatcttaaagaagacggcatgcaagcggcaaaagatatcaaactgctgctacttggt
gcaggagaatcaggaaaatcgactattgtaaaacagatgaaaattattcacgaatcggga
ttcacagcagaagactacaaacagtacaagccggttgtctacagtaacacggttcaatca
ttggtcgctattttgcgagccatgagcaacttaggcgtttcatttggttcggctgacaga
gaggtagatgcaaaattagtgatggatgtggtggcacgaatggaggacacagagccattc
tcagaagaattgctcagttcaatgaaacggttgtggggagacgcaggtgtacaggattgt
ttctcaaggagtaacgagtatcaattgaatgattcagccaaatatttccttgacgacctg
gaaaggttaggagaggcaatatatcaaccaactgagcaagatattctccgaactcgtgtc
aaaacaactggtattgttgaagttcacttcacattcaaaaatctcaatttcaaattgttc
gatgtgggaggtcaaagatcagaaaggaagaagtggattcattgtttcgaagatgttact
gctattattttctgtgttgccatgtcagagtatgatcaagtgttgcacgaagatgagaca
acaaaccgaatgcacgaatcgctgaagctgttcgattcgatctgtaataacaaatggttc
acagatacatcgattattctgttcctgaacaagaaggatctgtttgaagagaaaatcaag
aaaagcccgttaacgatctgcttcccagaatattcaggacgacaagactaccacgaggca
tctgcgtatattcaagcacaatttgaggctaaaaacaaatcagcgaataaggaaatctat
tgccacatgacatgtgccacagacacaactaacattcaatttgtgtttgacgctgtcacc
gatgtgattattgccaataatcttcgtggatgcggcttgtattaa

KEGG   Caenorhabditis elegans (nematode): CELE_E02C12.5
Entry
CELE_E02C12.5     CDS       T00019                                 

Gene name
gpa-3
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-3 subunit
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_E02C12.5 (gpa-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_E02C12.5 (gpa-3)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_E02C12.5 (gpa-3)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_E02C12.5 (gpa-3)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_E02C12.5 (gpa-3)
SSDB
Motif
Pfam: G-alpha Arf Roc Kinetochor_Ybp2 TniB Rad17 DAP3
Other DBs
NCBI-GeneID: 179319
NCBI-ProteinID: NP_001309498
WormBase: WBGene00001665
Ensembl: WBGene00001665
LinkDB
Position
V:complement(join(9357063..9357070,9357746..9357922,9357969..9358122,9358177..9358306,9358353..9358481,9358536..9358881,9359633..9359750))
AA seq 353 aa
MGLCQSAEDKELTLKSKAIDKEMMQNHMSQQKVVKLLLLGAGECGKSTVLKQMRILHDHG
FTAEEAEQQKSVVFNNTLQAMTAILKGMEALRMTFDKPIRENDAKFVMESHKMLQEAKVF
PEELANAIQALWNDKAVQQVIAKGNEFQMPESAPHFLSSLDRIKLPDYNPTEQDILLSRI
KTTGIVEVKFQMKSVDFRVFDVGGQRSERKKWIHCFEDVNAIIFIAAISEYDQVLFEDET
TNRMIESMRLFESICNSRWFINTSMILFLNKKDLFAEKIKRTSIKSAFPDYKGAQTYDES
CRYIEEKFDGLNANPEKTIYMHQTCATDTDQVQMILDSVIDMIIQANLQGCGL
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgggattatgccaatctgcagaggacaaagaactgacgttgaaatcaaaagcgatcgat
aaggaaatgatgcagaaccatatgtcacagcaaaaagttgtgaagcttctgcttttgggt
gctggagaatgtggaaaaagtacggttctgaaacaaatgaggattcttcacgatcacgga
tttactgcagaagaggctgaacaacagaaaagtgtcgttttcaataatacccttcaagca
atgactgcaattctgaaaggaatggaagcacttcgaatgacctttgataagccaattcga
gaaaatgatgcaaaatttgtgatggagtctcataaaatgctccaagaagcgaaagttttc
ccagaagaattagcaaatgccattcaagcattatggaatgataaagccgttcagcaagtt
attgcaaaaggaaatgagttccaaatgcctgaaagtgcaccacattttctatcaagtctt
gatcgtatcaagttacccgattataatccaactgaacaggatattcttctgtctagaatc
aagacaactggaattgttgaagttaaatttcaaatgaaaagtgtagattttagggtattt
gacgttggaggtcaacgatcagagagaaagaaatggattcattgttttgaagatgttaat
gcaattattttcatcgctgcaatttcagaatatgatcaagttctgtttgaagatgagacg
acgaatcgaatgattgaatcaatgaggctgtttgaatcaatttgtaattcacgatggttc
atcaatacttcaatgattcttttcttaaataagaaggatttgtttgccgagaagattaaa
agaacttcaattaaatccgcattcccagactataaaggtgcacaaacctacgacgaatcg
tgtcgatatattgaggaaaagtttgatggattgaatgcaaatccagaaaagacgatttac
atgcatcagacgtgtgcaacagatacagatcaagtacaaatgattttggactcagtgatt
gatatgattatccaggccaacttgcaaggatgcggcctctaa

KEGG   Caenorhabditis elegans (nematode): CELE_F38E1.5
Entry
CELE_F38E1.5      CDS       T00019                                 

Gene name
gpa-2
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-2 subunit
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F38E1.5 (gpa-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F38E1.5 (gpa-2)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_F38E1.5 (gpa-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_F38E1.5 (gpa-2)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_F38E1.5 (gpa-2)
SSDB
Motif
Pfam: G-alpha Arf Roc Ras Gtr1_RagA GTP_EFTU NdhM DnaI_N
Other DBs
NCBI-GeneID: 179219
NCBI-ProteinID: NP_505157
WormBase: WBGene00001664
Ensembl: WBGene00001664
UniProt: P22454
LinkDB
Position
V:join(8371014..8371131,8372152..8372246,8372292..8372381,8372428..8372508,8372558..8372643,8372689..8372817,8372867..8372996,8373268..8373421,8373499..8373686)
AA seq 356 aa
MGLCQSEEEKVGTLKSRAIDKEIKQLQTSEERTVKLLLLGAGECGKSTVLKQMRLLTSKQ
YTDEELLTQAKLVYTNIVIEMDHLVKAMPAAGLNFSDPMREHDVHMLTLYIKDMQHKNFQ
QDAADHVEKLWKDPVVKRLYAERKELNIRDIGDNTEYFFENLPRISKEDYHPNATDTLLL
RTKTTGIVEVGFEIKKVKFRVFDVGGQRSERKKWIHCFEDVNAIIFIAALSEYNEVLFED
ETTNRMIESMRLFESICNSRWFHNTNIILFLNKKDLFEEKIKKENIHKAFPEYRGEQNYA
ETVAFIKTKFEALSNNPKKTFYVHETCATDTNQVQKILDSVISMIIQSNLHKSGLY
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgggtctgtgccaaagtgaggaggaaaaagttggaacactgaaaagtcgtgcaattgat
aaggagataaaacagttgcaaacaagcgaggaacgaactgtcaaactattattgctagga
gccggagaatgtggaaagtcaacggtgctcaagcagatgagattgctcacgtcaaaacag
tacacagatgaggaacttttgacgcaggccaagttggtatacacaaacatagttattgaa
atggatcatttagtcaaagcaatgccagctgccggattgaatttttctgatccgatgaga
gaacatgatgttcacatgctgaccctctacattaaagatatgcaacataaaaacttccaa
caagacgctgcagatcatgtggagaaactatggaaagatccagtagtcaaaagactgtat
gccgagagaaaagaattgaatattcgagatattggtgataacacggaatacttttttgaa
aacctgccaagaatatcaaaagaagattatcacccaaatgcgacagacacccttcttttg
cggacaaagacaactggaattgtagaagttggatttgaaattaaaaaagtcaagtttaga
gtatttgacgtaggaggtcaacggtcggagagaaagaaatggattcattgttttgaagat
gtcaatgcaattattttcattgcagcgctttccgagtataacgaagttttgtttgaagat
gagacaacgaaccgaatgatcgaatccatgcgacttttcgaatcaatttgtaattctcga
tggttccataatactaatattatccttttcttgaacaaaaaggatttgttcgaggagaaa
atcaagaaggagaatattcataaggcgtttccggaatatcgaggagagcaaaattacgct
gaaacagtcgcatttatcaagacgaaattcgaggcgctttccaataacccgaagaagaca
ttctacgtgcacgaaacatgcgcaacagacacaaatcaagtgcaaaagattttggattca
gtaatttcgatgattattcaaagtaacctacacaaatctggactctattaa

KEGG   Caenorhabditis elegans (nematode): CELE_M04C7.1
Entry
CELE_M04C7.1      CDS       T00019                                 

Gene name
gpa-15
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-15 subunit
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_M04C7.1 (gpa-15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_M04C7.1 (gpa-15)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_M04C7.1 (gpa-15)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_M04C7.1 (gpa-15)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_M04C7.1 (gpa-15)
SSDB
Motif
Pfam: G-alpha Arf TRC8_N Reoviridae_Vp9
Other DBs
NCBI-GeneID: 172645
NCBI-ProteinID: NP_492312
WormBase: WBGene00001677
Ensembl: WBGene00001677
UniProt: P91907
LinkDB
Position
I:complement(join(8531821..8532011,8532054..8532207,8532256..8532385,8532903..8533031,8533554..8533714,8534064..8534205,8534330..8534493))
AA seq 356 aa
MGSTCSTPESKEQKRINSVIDKQIRKDEDDEIGNQKLLLLGTGECGKSTILKQINILHSS
GFSKADLKNVAGTVYSNIIQGVATLLKAKDHFYYELSTPELDADAQHILSLADSSKDAMP
FIPLTFNAIKRLWHDPVVQKTFERRAEFQMMDTLVYFMNELDRINNADYIPTVDDMLRIR
IPTMGVVQQTIEIKGTKFRIYDVGGQRSERRKWIHLFDNVNATIFISAINEFNQKLNEDG
QTNRMKESIKLFETICNSRWFVQAAMILFLNKRDLFEQKLKTTSINVLFSTYQGSNDYAE
CVAYIQMRFERLNKYSDIKKIYTHVTCATDTNQIQLVIDSVVDMVIGRNLRGTGME
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgggatcaacgtgctcaacgccggaaagcaaagaacaaaaacgaataaactcggttatt
gataaacagataagaaaggacgaggacgacgagattggtaatcagaaattgttacttctt
ggaactggagagtgtgggaaatcgaccattttaaagcaaataaatattcttcatagcagc
gggttttcaaaagcggacctgaaaaacgtggcgggtacggtgtatagcaatattatccaa
ggagtagcaacacttttgaaagcaaaggatcatttttattatgagctaagcactcctgaa
cttgatgctgatgctcaacatattttatcactggctgatagtagtaaagatgcgatgcca
tttattccattaacattcaatgctataaaacgattatggcatgatccagttgtacagaaa
actttcgaaagaagagccgaatttcaaatgatggatactctcgtttatttcatgaatgaa
ttggaccgaataaacaatgctgattatattccaactgtagatgatatgttacgaatacga
atacctacaatgggagttgtacaacaaactattgaaattaaaggaacaaagtttagaata
tacgatgttggaggacaacgctcagaacgccgaaaatggattcatctttttgataatgta
aatgcaacaatttttatatcagcaataaatgagttcaatcaaaaacttaatgaagatggt
caaacgaatcgaatgaaagaatcgataaagttattcgaaacaatatgcaattcccgttgg
tttgtgcaagctgcgatgattttatttttaaacaaacgggatttgtttgaacaaaaatta
aagacaacaagtattaatgtgctcttttcaacatatcaaggatcaaatgattatgccgag
tgtgttgcctatattcagatgcgttttgaacgacttaataaatattccgacattaagaaa
atttatacgcatgtaacgtgtgcaacagacacaaatcaaattcaattggtaattgatagt
gttgttgatatggttattggacgaaatttacgaggaacaggcatggaataa

KEGG   Caenorhabditis elegans (nematode): CELE_R10H10.5
Entry
CELE_R10H10.5     CDS       T00019                                 

Gene name
gpa-7
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-7 subunit
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_R10H10.5 (gpa-7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_R10H10.5 (gpa-7)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_R10H10.5 (gpa-7)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_R10H10.5 (gpa-7)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_R10H10.5 (gpa-7)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB DUF503 AAA_29
Other DBs
NCBI-GeneID: 177931
NCBI-ProteinID: NP_501921
WormBase: WBGene00001669
Ensembl: WBGene00001669
UniProt: Q21917
LinkDB
Position
IV:join(10404019..10404136,10405977..10406161,10406271..10406425,10406798..10407056,10407252..10407344,10407388..10407509,10408140..10408266)
AA seq 352 aa
MGHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDG
FSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVFATVHANKEELTE
ELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKT
TGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTN
RMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECIN
YIQWKFEQLNRSSQREIYCHHTCATDTNNVQFVLDACLDMIIAKNLKSMGLC
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggtcactgcacgagtaaagatcagaaagaaggcaaacgtctgaatcgtcggatcgat
gagcaaatcaagaaggatcaatcgatgagtcttcggatcatcaagttattactattagga
gccggagaaagtggaaagagtacaatattaaaacaaatgaggatattacacaaggatgga
ttctcacaacaagatcttgaaatgattcggcctgttgtatattcgaattgtattcacagt
atgctttcaattctccgagccatgttccatttgcaaatcgaatacggcgaacctgatcga
gtgcgtgactcccagttagtgtttgcaactgtgcatgcaaataaagaagaattaacagaa
gaactagcagcagcaatgcagaggttatggcatgatccaggtgtccgagaatgctatcga
cgcagcaatgaataccaaattgatgactctgcaaaatacttccttgacaacttgccacgt
ctctcatctccaaactacgtgccaagtgagcaggatcttttgaggacacgaataaaaaca
acaggaataacagaagttttgtttgaactgaaagggctcacatttcgagtgatagatgtt
ggagggcaacgatcagaaagaaagaaatggattcattgtttcgataatgttaatgcaatc
atttttatatcatctttatcagagtatgatcaaactttgagagaagataattgcacgaac
cgaatgcaagaatcattgaaactgtttgactcaatctgtaatagtccatggtttgcggat
attcactttattttatttttaaataagaaggacttgttcgctgaaaaaattgtccgatca
ccattgaccgtttgcttcccagaatacaagggacaacagaatcaaacagaatgtattaat
tacattcaatggaagtttgaacaacttaataggtcctcccaacgtgaaatctattgtcat
cacacatgtgccacagacacaaataacgttcaattcgtgttggacgcctgtctcgatatg
attattgccaaaaatctcaagtcgatgggactgtgttaa

KEGG   Caenorhabditis elegans (nematode): CELE_T19C4.6
Entry
CELE_T19C4.6      CDS       T00019                                 

Gene name
gpa-1
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-1 subunit
  KO
K04534  guanine nucleotide-binding protein G(o) subunit alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_T19C4.6 (gpa-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_T19C4.6 (gpa-1)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_T19C4.6 (gpa-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_T19C4.6 (gpa-1)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    CELE_T19C4.6 (gpa-1)
SSDB
Motif
Pfam: G-alpha Arf Roc GTP_EFTU Gtr1_RagA AAA_29 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 179546
NCBI-ProteinID: NP_505840
WormBase: WBGene00001663
Ensembl: WBGene00001663
UniProt: P28051
LinkDB
Position
V:complement(join(11174567..11174757,11174930..11175089,11175145..11175403,11175938..11176024,11176152..11176225,11176269..11176410,11176681..11176723,11177442..11177559))
AA seq 357 aa
MGNCESRELVAQAKQNKIINTELDKAKKTDENIIKLLLLGAGESGKSTVLKQMKIIHNSG
FSQEEISNKRNVVCANTVQAMGALLDGMKQLQFDFSTRVCNAHEKLIRETLNDKAEYGPF
SDAMFNALTELWADKGVQCAYDKREFFYLHDSAKYFFDAIARVHTPNYVPTENDILHTRV
PTMGVIEVNFTIKGKFFRVFDVGGQRSQRKKWIHCFDDAKAMIYVASLSEYDQVLLEDNT
TNRMHESIQLFKQVINNKYFVNTSVILFLNKIDLFEEKIVTKKRSLGIAFESFSGPSQDL
NAAVAFVEKKYRSMAENKEKNIYCHHTCATDTQQVQYVLDAVLDTILSTKLKGCGLY
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgggaaactgcgaaagtcgagaacttgtagctcaagccaaacagaataaaataatcaac
acggaacttgataaggccaaaaaaaccgatgaaaatataatcaaattattgctgttagga
gctggagagagtggaaaaagtaccgtgctgaaacaaatgaaaatcatccataacagtgga
ttctctcaagaagaaatatcaaataaacgaaatgttgtctgtgcgaatactgtgcaagca
atgggagcattgttagatggaatgaaacaacttcaattcgatttttcaacccgagtttgt
aatgcacatgagaagttgatacgtgaaacattgaatgataaagctgagtatggaccattc
agtgatgcaatgttcaacgcacttactgagttgtgggcggacaaaggagttcagtgtgca
tacgataagcgagagtttttttaccttcatgattctgcaaaatatttctttgatgcaatt
gcaagggttcacactcccaattacgtaccaactgaaaatgatattctgcatacacgggtt
ccaacaatgggtgttatagaagttaatttcacaataaagggcaaattttttcgagtattt
gatgtgggcggacagcgatcgcaaaggaagaaatggattcactgttttgatgatgcaaaa
gctatgatatatgttgcttcgttgtcagagtatgatcaagttttattagaagacaatact
actaatcgaatgcacgaatcaatacagttatttaagcaagtaatcaacaataaatatttt
gtaaacacttcagttatattattcctgaacaaaattgatttattcgaggaaaaaattgtt
accaaaaaacgaagtcttggtattgcatttgagtcatttagtggaccgagccaagatctc
aatgcagctgtagcgttcgttgaaaaaaagtatagaagtatggcagagaacaaagagaag
aacatttattgtcatcacacttgtgctacagacacacaacaggtgcagtacgtactcgat
gcggttctagatacgatactatctaccaaactgaagggatgtggattgtattga

DBGET integrated database retrieval system