KEGG   Caenorhabditis elegans (nematode): CELE_C34B2.7Help
Entry
CELE_C34B2.7      CDS       T00019                                 

Gene name
sdha-2
Definition
(RefSeq) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00020  Citrate cycle (TCA cycle)
cel00190  Oxidative phosphorylation
cel01100  Metabolic pathways
cel01200  Carbon metabolism
Module
cel_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cel_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cel_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CELE_C34B2.7 (sdha-2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CELE_C34B2.7 (sdha-2)
Enzymes [BR:cel01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CELE_C34B2.7 (sdha-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 172968
NCBI-ProteinID: NP_492798
WormBase: WBGene00016392
Ensembl: WBGene00016392
UniProt: O44954
LinkDB All DBs
Position
I:complement(join(10683378..10683776,10683828..10684017,10684061..10684328,10684373..10685047,10685093..10685245,10685293..10685471,10685525..10685583))
Genome map
AA seq 640 aa AA seqDB search
MLNVVKSINRAKTPVRTYMKKQVSATTNFDVVDHTFDAVVVGAGGAGLRAAMGLSEGGMK
TAVITKLFPTRSHTVAAQGGVNAALGNMNPDNWRWHFYDTVKGSDWLGDQDAIHYMTREA
ERAIIELENYGMPFSRTTDGKIYQRAFGGQSNDFGRGGQAHRTCCVADRTGHSLLHTLYG
ASLQYDCNYFVEYFALDLIMDKGKCIGVVALDIETGQIHRFRAKNTVLATGGYGRAYFSC
TSAHTCTGDGTALTARAGIRNSDMEFVQFHPTGIYGVGCLITEGSRGEGGYLVNSQGERF
MERYAPNAKDLASRDVVSRAMTMEINEGRGVGPNKDHIYLQLHHLPAEQLQQRLPGISET
AQIFAGVDVTKEPIPVIPTVHYNMGGVPTNYKGQVLDFTPEGGDKVIPGLYAAGECAAHS
VHGANRLGANSLLDLVIFGRSCALTILNENKPGDSIPELPVNCEEKSCDNLNGLLHSKGD
ISSIELRQKMQMTMQKHAAVFRRGDLLKEGVDKMSSIYKEQQNLKACADSGKVWNSELVE
TLELQNLLINANQTIVAAENRTESRGAHARDDFQERIDEYDYSNPLEGQQKKPFDQHWRK
HSIIGIDTKTGAVDLTYRPVIDKTLDKSETDWVPPKVRSY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgtcgtaaagtcgataaaccgtgcgaaaacacctgttcgcacttatatgaaa
aaacaagtgagcgcaaccaccaattttgatgtcgttgatcacacttttgacgcggttgtt
gtgggagcaggaggagccggtttgagagctgcgatgggactctccgaaggtggaatgaaa
actgccgtcattacgaagcttttccccacaagatcgcacacagtcgcggctcaaggaggt
gtgaacgccgctttgggaaatatgaatccagataactggcgctggcacttctacgacact
gtaaaagggtccgattggcttggagatcaagacgcgattcactatatgactcgagaagcc
gaaagagctattattgaacttgaaaattacggaatgcctttctcgcgtacaacagacgga
aaaatttatcaacgggcttttggaggtcaatctaatgatttcggtcgtggaggacaggct
caccgtacttgctgtgtggccgatagaactggacactcacttcttcataccctctacggt
gcatctcttcaatacgactgtaattattttgtcgagtatttcgctttggatttgattatg
gataagggaaaatgcattggcgtcgttgcactggacattgaaactggacagattcatcgt
ttccgcgcaaagaacactgtcctcgccaccggaggctatggaagagcttacttctcgtgt
acatctgctcacacttgtactggtgatggaaccgctcttaccgctcgtgcaggtattcgt
aattctgatatggagtttgttcaattccatccaactggaatctacggagttggatgtttg
atcaccgaaggatcacgaggagagggtggatatttggtcaattcgcaaggagaacgattt
atggaaagatatgcaccgaatgccaaggatttagcgtcaagagatgttgtttcaagagcc
atgactatggaaattaatgaaggaagaggagtcggaccaaacaaagatcatatttacctt
caattgcatcatcttccagctgaacagcttcaacaacgattgccaggaatctcggaaacc
gctcaaatctttgctggtgtggatgtaaccaaagagccgattccagtcattccaactgtt
cactacaacatgggaggagttcctacgaattacaagggacaagttctcgatttcacacct
gaaggaggagataaagtgattccaggactctatgccgctggtgaatgtgcagcacattca
gttcatggagcaaatcgtctcggagcaaattcccttctagatttggttatctttggaaga
tcttgcgctctcactatccttaatgagaacaaaccaggagattcaatcccggagcttccg
gtaaattgtgaagagaaatcgtgtgacaatttgaacggacttttgcactcaaaaggagat
atttcatctatcgaattaagacaaaagatgcaaatgacaatgcagaaacatgctgctgtt
ttcagacggggcgatcttttgaaggaaggagtcgataaaatgtcctccatctacaaagag
caacaaaatttgaaggcgtgtgccgactctggaaaagtatggaattcggagcttgtcgaa
actctcgagcttcagaatttgcttatcaacgccaatcaaaccatcgtcgccgccgaaaat
cgcactgaatctcgtggagcccacgctcgtgatgatttccaagaaagaattgacgaatat
gactacagcaatccacttgagggacagcagaaaaaaccgtttgatcagcactggcgcaag
cattccatcatcggtatcgatacgaaaactggagctgttgatttgacataccgcccagtt
atcgacaaaactctcgataaatctgaaaccgactgggttccaccaaaggtccgatcgtat
taa

DBGET integrated database retrieval system