KEGG   Caenorhabditis elegans (nematode): CELE_C35D10.9
Entry
CELE_C35D10.9     CDS       T00019                                 

Gene name
ced-4
Definition
(RefSeq) Cell death protein 4
  KO
K20105  cell death protein 4
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04215  Apoptosis - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_C35D10.9 (ced-4)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C35D10.9 (ced-4)
SSDB
Motif
Pfam: NB-ARC CARD AAA_16 AAA_22 DUF2075
Other DBs
NCBI-GeneID: 175643
NCBI-ProteinID: NP_001021202
WormBase: WBGene00000418
UniProt: P30429
LinkDB
Structure
PDB: 

Position
III:join(4852325..4852775,4852827..4852920,4852966..4853055,4853242..4853308,4853359..4853696,4854254..4854529,4854578..4854683,4854730..4854957)
AA seq 549 aa
MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRI
YRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLL
LGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLI
GINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALI
DRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYD
FLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGL
VGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICS
NEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISIL
EQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFY
DSLKNFACC
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgctctgcgaaatcgaatgccgcgctttgagcacggcacacacgaggctcatccacgac
tttgaaccacgtgacgcattgacttatttagaaggcaaaaacattttcacagaagatcat
tctgaacttatcagtaaaatgtcaactcgcctcgagaggatcgccaattttcttcgaatc
tatcgacgtcaagcttctgaacttggaccactcatcgactttttcaactacaacaatcaa
agtcaccttgctgatttcctcgaagactacatcgattttgcgataaatgagccagatcta
cttcgtccagtagtgattgctccacaattttcccgacaaatgctcgataggaaactattg
cttgggaatgttccaaaacaaatgacatgctatattcgagagtatcacgtggatcgagtg
atcaaaaagctcgacgagatgtgtgatttagactccttttttctgtttctacacggccga
gctggatccggaaaatcagtaattgcatcacaagctctttcgaaatctgaccaacttatt
ggaataaattatgattcaatcgtttggctcaaagatagtggaacagctccaaaatctaca
ttcgatttatttacggatattttgctgatgctaaaaagcgaagacgatcttctcaatttc
ccatcggtggagcatgtcacgtcagttgtactcaaaaggatgatctgcaacgcactcatt
gatcgtccaaatactttattcgtatttgatgacgtagttcaagaagaaacaattcgttgg
gctcaggagctacgtcttcgatgtcttgtaactactcgtgacgtggaaatatcaaatgct
gcttctcaaacatgcgaattcattgaagtgacatcattggaaatcgatgaatgttatgat
tttctagaagcttatggaatgccgatgcctgttggagaaaaagaagaagatgtgcttaat
aaaacaatcgaactaagcagtggaaatccagcaacgcttatgatgtttttcaagtcttgt
gaaccgaaaacatttgaaaaaatggcacagcttaataacaaattggaaagtcgaggatta
gtcggtgttgaatgtatcaccccttactcgtacaagtcactcgcaatggctcttcaaaga
tgtgttgaagttttgtcagatgaggatcgaagtgctcttgctttcgcagttgtgatgcct
cctggagttgatatacccgtcaagctatggtcatgtgttattccagttgatatttgttca
aatgaagaagaacaattggatgatgaagttgcggatcggttgaaaagactcagcaaacgt
ggagctcttctcagtggaaaacgaatgcccgttttgacattcaaaattgatcatattatc
catatgttcttgaaacacgtcgttgatgcacaaactatcgccaatggaatctcaattctc
gagcagcgtcttcttgaaataggaaacaataatgtatcagtaccggagcgacatatacca
tcacatttccaaaaattccgtcgttcatcagccagtgagatgtatccaaaaactacagaa
gaaactgtgatccgtcctgaagacttcccaaagttcatgcaattgcaccagaaattctat
gactccctcaaaaattttgcatgctgttaa

DBGET integrated database retrieval system