KEGG   Caenorhabditis elegans (nematode): CELE_C36E8.5Help
Entry
CELE_C36E8.5      CDS       T00019                                 

Gene name
tbb-2
Definition
(RefSeq) Tubulin beta-2 chain
  KO
K07375  tubulin beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C36E8.5 (tbb-2)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_C36E8.5 (tbb-2)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_C36E8.5 (tbb-2)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C36E8.5 (tbb-2)
  Exosomal proteins of colorectal cancer cells
   CELE_C36E8.5 (tbb-2)
  Exosomal proteins of bladder cancer cells
   CELE_C36E8.5 (tbb-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 175519
NCBI-ProteinID: NP_497806
WormBase: WBGene00006537
Ensembl: WBGene00006537
UniProt: P52275
LinkDB All DBs
Structure
PDB: 

Position
III:complement(join(4016066..4016259,4016315..4016788,4016866..4017384,4017457..4017622))
Genome map
AA seq 450 aa AA seqDB search
MREIVHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLERIDVYYNEANNGKYV
PRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVI
RKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTVAAMFRGRMSMREVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFVGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLIS
EYQQYQEATAEDDVDGYAEGEAGETYESEQ
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatcgtccacgtgcaagccggacaatgcggaaaccaaatcggatccaaattc
tgggaggtcatctccgacgagcacggaatccagccagacggaaccttcaagggagagacg
gatctccagcttgagcgcattgacgtctactacaacgaagccaacaacggaaagtatgtg
ccacgcgccgtgttggtcgatctcgaaccaggaaccatggattctgtccgctctggacca
ttcggccagctgttccgtcctgacaactttgtgttcggacaaagcggagccggaaacaac
tgggccaagggtcactacacagaaggagctgagcttgtcgacaatgtgcttgacgtgatc
cgcaaggaagccgaaggatgcgattgtcttcaaggattccaactcactcactctctcgga
ggaggaaccggatctggaatgggaacacttctcatctccaaaatccgcgaagagtaccca
gacagaatcatgagctcattctcggttgtaccatcgccaaaggtgtccgacacagttgta
gaaccatacaatgccaccctctccgtccaccagcttgttgagaacaccgatgagacctac
tgcattgacaacgaggccctctacgacatctgctaccgtaccctcaaactcaccaaccca
acctacggtgatttgaaccatcttgtatccctcaccatgtccggagttaccacctgtctc
cgattcccaggacagctcaatgccgatctccgcaagcttgccgtcaacatggttccattc
ccacgtcttcacttcttcatgccaggattcgcaccactttccgccaagggaacccaggct
taccgtgcccttaccgtcgccgagctcacccaacaaatgttcgatgccaagaacatgatg
gctgcctgtgacccaagacacggacgttacctgaccgtggccgctatgttccgtggacgc
atgtcgatgagagaggttgacgagcaaatgctcaacgttcagaacaagaactcgtcctac
ttcgtcgaatggatcccgaacaacgtcaagaccgccgtttgtgacatcccaccaagagga
ctcaagatggctgccaccttcgttggaaactcgaccgctatccaagagcttttcaagcgt
atctcagagcagttcactgctatgttccgccgcaaggctttcctccattggtacactgga
gaaggaatggacgagatggagttcaccgaagccgagagcaacatgaacgatctcatctca
gaataccaacaataccaagaagcaactgccgaagacgacgtcgacggatacgctgaggga
gaagctggagagacttacgaatcggagcaataa

DBGET integrated database retrieval system