KEGG   Caenorhabditis elegans (nematode): CELE_C44B11.3Help
Entry
CELE_C44B11.3     CDS       T00019                                 

Gene name
mec-12
Definition
(RefSeq) Detyrosinated tubulin alpha-3 chain
  KO
K07374  tubulin alpha
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C44B11.3 (mec-12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_C44B11.3 (mec-12)
   03036 Chromosome and associated proteins [BR:cel03036]
    CELE_C44B11.3 (mec-12)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cel04812]
    CELE_C44B11.3 (mec-12)
   04147 Exosome [BR:cel04147]
    CELE_C44B11.3 (mec-12)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_C44B11.3 (mec-12)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_C44B11.3 (mec-12)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_C44B11.3 (mec-12)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_C44B11.3 (mec-12)
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C44B11.3 (mec-12)
  Exosomal proteins of colorectal cancer cells
   CELE_C44B11.3 (mec-12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3 MSP
Motif
Other DBs
NCBI-GeneID: 175419
NCBI-ProteinID: NP_497663
WormBase: WBGene00003175
Ensembl: WBGene00003175
UniProt: P91910
LinkDB All DBs
Position
III:complement(join(3131733..3132029,3133691..3134125,3134731..3135125,3137527..3137749,3139132..3139134))
Genome map
AA seq 450 aa AA seqDB search
MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDDSFSTFFSETGSGR
HVPRAVMVDLEPTVIDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLD
RIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHN
QMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDLAALEKDYEEVGVDSMEDNGEEGDEY
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagtaatttcgattcacatcggacaagccggagtccaaatcggaaatgcttgc
tgggagctctactgcctggagcacggaattcagcccgatggtcaaatgccttctgacaag
tccctcggaggatccgatgactctttcagcactttcttctcggaaactggaagtggacgt
catgtgccaagagccgtcatggtcgacttggagccaactgtcattgacgaaatccgcact
ggaacctatcgctccctcttccacccggaacaactcatcactggtaaggaagatgccgca
aataactacgctcgtggtcactacaccatcggaaaagaaatcatcgacctaacccttgac
cgtatccgccgtctagctgacaactgtaccggacttcaaggattcctagtgttccactct
ttcggaggaggtactggatccggtttcacttctcttttgatggaaagactatctgtggac
tatggaaaaaaggccaagctcgagttctccatctatccggctcctcaagtctccactgct
gtcgtagagccatataactcgattttgaccacccataccactttggagcactcggattgc
tcatttatggttgataatgaggcaatctacgacatttgccgtcgcaacctggacatcgaa
cgtccatcctacacaaatttgaatcgtctcatcggtcaaatcgtcagctccatcaccgct
tccctccgattcgacggagccctcaacgtcgacttgaccgagttccagacaaacttggtt
ccctatccacgtattcacttcccgctagccacattttctccggttatctcagcggaaaaa
gcctatcacgagcagctatcagtggctgaaatcactaatatgtgcttcgagccacataac
cagatggtcaagtgtgatccgagacacggaaagtatatggcagtttgtctgcttttccgt
ggagatgtagtgccaaaggatgtgaatgctgcaattgcaactattaagactaagagaagc
attcaatttgtagattggtgcccaactggatttaaggtcggaatcaactaccaaccacca
acggtagtcccaggaggtgacctggcaaaggtaccccgtgccgtgtgcatgctctccaac
accaccgcaatcgctgaagcctgggctcgtctggaccataaattcgacctaatgtatgcg
aagagagcattcgtccactggtatgttggtgaaggaatggaggaaggagaatttagtgag
gctcgtgaagatttggctgctcttgagaaggattatgaggaagtcggtgtggacagtatg
gaggataatggagaagaaggagatgagtattag

DBGET integrated database retrieval system