KEGG   Caenorhabditis elegans (nematode): CELE_C46F4.2
Entry
CELE_C46F4.2      CDS       T00019                                 

Symbol
acs-17
Name
(RefSeq) fatty Acid CoA Synthetase family
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00061  Fatty acid biosynthesis
cel00071  Fatty acid degradation
cel01100  Metabolic pathways
cel01212  Fatty acid metabolism
cel04146  Peroxisome
Module
cel_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CELE_C46F4.2 (acs-17)
   00071 Fatty acid degradation
    CELE_C46F4.2 (acs-17)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CELE_C46F4.2 (acs-17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cel01004]
    CELE_C46F4.2 (acs-17)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_C46F4.2 (acs-17)
Enzymes [BR:cel01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CELE_C46F4.2 (acs-17)
Lipid biosynthesis proteins [BR:cel01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CELE_C46F4.2 (acs-17)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CELE_C46F4.2 (acs-17)
  Exosomal proteins of breast cancer cells
   CELE_C46F4.2 (acs-17)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 180859
NCBI-ProteinID: NP_508993
WormBase: WBGene00016716
Ensembl: WBGene00016716
UniProt: Q18660
LinkDB
Position
X:complement(join(5937960..5938111,5938402..5938674,5938735..5939504,5939707..5939854,5940105..5940353,5940413..5940497,5940546..5940726,5941627..5941748,5941802..5941894,5941956..5942039))
AA seq 718 aa
MVDESDVKSALNGHDRPFTITLAIVLLKIVFFIYDVVTFIPFKIFADPAEKLEKSERVKA
EPDNGDPTTPWKNVSAKDGLMNSSFEGIHDLGTQWEECVRRYGNQPCMGTREVLKVHKEK
QSNGKIFEKWQMGDYHWRSYAQVDKRVNMIASGLTSLGQQEKEPIILFAETREEWMTTAL
ACMKMNFPIATMYATLGDEAVQFAINEVGAKTIFTSEALISKVKKAMSNGATSIENIIFF
DSVDPASRGESVDVDLPFTLLSFDQLLSRGEPYPVPTRSKKDDLAFIMYTSGTTGNPKGV
MISHQNIVAVTAGQAFNIVLGPDDRYIGYLPLAHILEVCAEMVVFTKGVRIGYSSAQTLF
DRAPKIMKGEHGDCWVLQPTLMACVPAVMDRIFKAVIDEVNANSELFKQLFKTCYERKRS
RYEEGYTSFILNKLVFNRIGKLLGGKVRQILSGGAPLSPETQRFMNICFCCPVVQGYGLT
ETCGGGTIADIHDLSTGTVGPPLTCCEILLQEWAEAGYSPKNDPPQGEILISGPNVALGY
FKNDEKTKEEFVKVNGKTFFATGDIGEFREDGSLKIIDRKKDLLKLAHGEYISLGKVETN
LLTNPNVDNVCVYGDSNKSFLVALVVPNQKNLTQLASKAGASNDNFEKLCEDKKVVEALQ
KELAQYGASKLQRVEIPQKIFICHEPWTPASGLLTEALKLKRKNIEKAFRKELDELYK
NT seq 2157 nt   +upstreamnt  +downstreamnt
atggtggacgaatctgacgtcaaatcagccttgaatggtcatgatcgtccatttacaatt
actcttgccattgttttgctaaagattgtatttttcatttacgatgtcgtcactttcatt
ccattcaaaatatttgcggacccggcggagaaactcgaaaagtcggagagagtcaaggct
gagccagataatggagatccaacaacaccatggaagaacgtgtctgcaaaagacgggctc
atgaactcttcatttgaaggaatccatgatcttggtactcaatgggaagaatgtgtccga
cgttacggaaaccaaccgtgtatggggactcgtgaagttcttaaagtccacaaggagaaa
caatcaaacggaaaaatctttgaaaaatggcaaatgggagactatcactggagaagctat
gctcaggttgacaaacgggttaatatgattgcatcgggtttgacgagcctagggcagcag
gagaaggagccaattattctttttgccgagaccagagaagaatggatgacaactgctttg
gcctgcatgaaaatgaattttccaattgcaacaatgtatgctactcttggagacgaagca
gttcagtttgctattaatgaagttggagccaagaccatcttcacttcggaagctctcatc
tcgaaagtcaaaaaggcgatgagcaacggagccacatccatcgaaaacattatcttcttt
gatagtgtcgatccagcatctcgtggagagtcggtcgatgttgatcttccattcaccctt
ctttcttttgaccagcttctcagccgcggagagccttacccagtaccaactcgcagtaag
aaagatgatctcgccttcatcatgtacacatctggaactactggaaatccgaaaggagtt
atgatttctcatcagaatattgttgctgttaccgctggacaagccttcaacatcgttctc
ggaccagatgaccgatatatcggatatctccctcttgctcacattttggaagtatgcgca
gaaatggtcgttttcactaaaggagtccgcattggttactcatcagctcagaccttattt
gacagagcaccaaaaattatgaaaggagagcacggagactgctgggttcttcagccaact
cttatggcttgtgtccctgctgtcatggatcgcatcttcaaagctgtcatcgatgaggtt
aacgctaacagtgaacttttcaagcaactcttcaaaacttgttacgaaagaaaacggtcc
cgttatgaagaaggatatactagttttattttgaacaagcttgttttcaatagaatcggt
aaacttcttggaggaaaagttcgacaaattctttctggaggagctccattgagcccagaa
acacaaagattcatgaacatttgcttctgctgtccagttgtacaaggatacgggctcact
gaaacctgcggaggaggaactattgccgacattcatgatttgtcaactggaactgtggga
ccaccgctcacatgttgcgaaattctgttgcaagaatgggcagaggctggatactcaccg
aaaaatgatcctccacaaggagaaattcttattagtggaccaaatgttgcgttgggatat
ttcaaaaatgacgaaaaaaccaaggaagagtttgttaaagtcaatggaaaaacattcttc
gcaactggagatattggtgaattccgcgaagatggatctctcaagattattgaccgtaag
aaggacttgctcaaattggctcacggtgaatatatttccctcggaaaagttgaaactaat
cttttgactaatccaaatgttgacaacgtctgcgtgtatggtgattcgaacaaaagcttc
ctggttgcgttggtcgttccaaatcaaaagaatctaactcaattggccagtaaagctggt
gcaagcaatgataactttgagaagctctgcgaagataagaaggttgtagaggcattgcaa
aaggagttggctcaatatggagcttccaaacttcaacgcgtcgaaattccacaaaaaatc
tttatttgtcacgagccatggaccccagcctccgggcttcttaccgaagccttgaagctc
aaaagaaaaaatatcgagaaggccttccgcaaagaacttgatgagctttataaatag

DBGET integrated database retrieval system