KEGG   Caenorhabditis elegans (nematode): CELE_C48D1.2
Entry
CELE_C48D1.2      CDS       T00019                                 

Gene name
ced-3
Definition
(RefSeq) Cell death protein 3 subunit P17
  KO
K20106  cell death protein 3
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04215  Apoptosis - multiple species
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_C48D1.2 (ced-3)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_C48D1.2 (ced-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_C48D1.2 (ced-3)
Peptidases and inhibitors [BR:cel01002]
 Cysteine peptidases
  Family C14: caspase family
   CELE_C48D1.2 (ced-3)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2 BAG
Other DBs
NCBI-GeneID: 178272
NCBI-ProteinID: NP_001255708
WormBase: WBGene00000417
Ensembl: WBGene00000417
UniProt: P42573
LinkDB
Structure
PDB: 
4M9R

Position
IV:complement(join(13199230..13199292,13199769..13200008,13200363..13200490,13200545..13200758,13201671..13202002,13203191..13203444,13203723..13203868,13203932..13204066))
AA seq 503 aa
MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKA
VQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPA
GYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSS
ANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSS
PRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAK
HESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRG
ERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYA
TTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQ
MPEMTSRLLKKFYFWPEARNSAV
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgatgcgtcaagatagaaggagcttgctagagaggaacattatgatgttctctagtcat
ctaaaagtcgatgaaattctcgaagttctcatcgcaaaacaagtgttgaatagtgataat
ggagatatgattaattcatgtggaacggttcgcgagaagagacgggagatcgtgaaagca
gtgcaacgacggggagatgtggcgttcgacgcgttttatgatgctcttcgctctacggga
cacgaaggacttgctgaagttcttgaacctctcgccagatctgttgactcgaatgctgtc
gaattcgagtgtccaatgtcaccggcaagccatcgtcggagccgcgcattgagccccgcc
ggctacacttcaccgacccgagttcaccgtgacagcgtctcttcagtgtcatcattcact
tcttatcaggatatctactcaagagcaagatctcgttctcgatcgcgtgcacttcattca
tcggatcgacacaattattcatctcctccagtcaacgcatttcccagccaaccttcatcc
gccaactcttcattcaccggatgctcttctctcggatacagttcaagtcgtaatcgctca
ttcagcaaagcttctggaccaactcaatacatattccatgaagaggatatgaactttgtc
gatgcaccaaccataagccgtgttttcgacgagaaaaccatgtacagaaacttctcgagt
cctcgtggaatgtgcctcatcataaataatgaacactttgagcagatgccaacacggaat
ggtaccaaggccgacaaggacaatcttaccaatttgttcagatgcatgggctatacggtt
atttgcaaggacaatctgacgggaaggggaatgctcctgacaattcgagactttgccaaa
cacgaatcacacggagattctgcgatactcgtgattctatcacacggagaagagaatgtg
attattggagttgatgatataccgattagtacacacgagatatatgatcttctcaacgcg
gcaaatgctccccgtctggcgaataagccgaaaatcgtttttgtgcaggcttgtcgaggc
gaacgtcgtgacaatggattcccagtcttggattctgtcgacggagttcctgcatttctt
cgtcgtggatgggacaatcgagacgggccattgttcaattttcttggatgtgtgcggccg
caagttcagcaagtgtggagaaagaagccgagccaagctgacattctgattgcatacgca
acgacagctcaatatgtttcgtggagaaacagtgctcgtggatcatggttcattcaagcc
gtctgtgaagtgttctcgacacacgcaaaggatatggatgttgttgagctgctgactgaa
gtcaataagaaggtcgcttgtggatttcagacatcacagggatcgaatattttgaaacag
atgccagagatgacatcccgcctgctcaaaaagttctacttttggccggaagcacgaaac
tctgccgtctaa

DBGET integrated database retrieval system