KEGG   Caenorhabditis elegans (nematode): CELE_C54C6.2Help
Entry
CELE_C54C6.2      CDS       T00019                                 

Gene name
ben-1
Definition
(RefSeq) Tubulin beta chain
  KO
K07375  tubulin beta
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04145  Phagosome
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    CELE_C54C6.2 (ben-1)
Chromosome and associated proteins [BR:cel03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     CELE_C54C6.2 (ben-1)
Cytoskeleton proteins [BR:cel04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    CELE_C54C6.2 (ben-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CELE_C54C6.2 (ben-1)
  Exosomal proteins of colorectal cancer cells
   CELE_C54C6.2 (ben-1)
  Exosomal proteins of bladder cancer cells
   CELE_C54C6.2 (ben-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 175461
NCBI-ProteinID: NP_497728
WormBase: WBGene00000248
Ensembl: WBGene00000248
UniProt: Q18817
LinkDB All DBs
Position
III:complement(join(3538326..3538501,3539311..3539784,3539842..3540004,3540057..3540412,3541428..3541593))
Genome map
AA seq 444 aa AA seqDB search
MREIVHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDLQLERINVYYNEANGGKYV
PRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVV
RKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLSNPTYGDLNHLVSVTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGAQAYRALTVAELTQQMFDAKNMM
AACDPRHGRYLTVAAMFRGRMSMREVDDQMMNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATAEEDGELDGTDGDAE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattgttcacgttcaagccggacaatgtggtaatcaaatcggagccaagttc
tgggaagtgatatccgatgagcatgggatccagcctgatggaacttataagggagaaagt
gatttgcagttggaaagaatcaatgtctactataatgaggctaatggcggcaaatatgtc
ccacgcgctgttctcgtcgatcttgagccaggaaccatggattctgtccgctctggacca
ttcggccagctgttccgtccagataactttgtgttcggacaatccggagccggaaacaac
tgggccaagggtcactacaccgaaggagccgaacttgtcgataatgtgctcgacgtagtt
cgaaaagaggctgaaggatgtgattgtcttcaaggattccagttgactcattcacttgga
ggaggaactggatctggaatgggaactcttctcatttcgaaaatccgtgaagagtatcca
gatagaattatgagttctttctcggttgttccgtcgccaaaggtctcggacacagtcgtc
gagccatacaacgctactctttctgtccaccagctcgttgaaaataccgatgagactttc
tgcattgacaacgaggctctttatgatatctgcttcagaaccctcaagctttcaaatcca
acttatggagatctcaatcatcttgtttccgttacaatgtccggagtcaccacgtgcctc
cgcttcccaggacaactcaatgctgatctccgcaaacttgcagtcaacatggttccattc
ccacgtcttcacttctttatgccaggatttgctccattgtcagctaaaggagcacaagcg
taccgtgcacttacggtcgccgagcttacccagcagatgtttgacgccaagaatatgatg
gctgcctgtgatccgagacacggacgttacctgactgtagctgcaatgttccgtggacgt
atgtcaatgagagaagtcgatgatcaaatgatgaatgtgcagaataagaactcttcgtat
tttgttgaatggattccgaataatgtgaagactgcggtctgtgatattccaccacgtggg
ctcaagatgtcggccacttttattggaaactcgacagctattcaggagttgttcaagaga
atctctgaacaatttacagcaatgttccgccgcaaggctttcctccattggtatactggc
gaaggaatggacgagatggaattcactgaagctgagagtaatatgaacgatcttgtctca
gaataccagcaataccaggaagcaactgcagaggaagatggagaacttgatggaactgat
ggagatgctgaatag

DBGET integrated database retrieval system