KEGG   Caenorhabditis elegans (nematode): CELE_D1005.3
Entry
CELE_D1005.3      CDS       T00019                                 

Gene name
cebp-1
Definition
(RefSeq) C/EBP (CCAAT/enhancer-binding protein) homolog
  KO
K23479  CCAAT/enhancer binding protein (C/EBP), other
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_D1005.3 (cebp-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_D1005.3 (cebp-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    CELE_D1005.3 (cebp-1)
SSDB
Motif
Pfam: bZIP_2
Other DBs
NCBI-GeneID: 180481
NCBI-ProteinID: NP_508276
WormBase: WBGene00016997
Ensembl: WBGene00016997
UniProt: Q18909
LinkDB
Position
X:complement(join(1452801..1452861,1452911..1453656,1453706..1453858))
AA seq 319 aa
MYSKLNYSHQKGDQALKHPHLVRLQQSEVRGFTDMPNNGASTSSAGSFARQDSLTIAASL
QQRDRERHPVDFMETELDLGDYLQVLHDLDVPTDNVDFDDAELQKCNILYDGEHPYEQPE
LNGYERHVAYGTGYRVPGDYDQDGYKMNCEVKAETPDFGATKTRRAVKRPVPYDDYQKEY
SEESSDMTDNDGSVDDSYFEPKSKKTKSAGLENFKPQTRARKYKLKADEEKAEPTYKLKR
ARNNDAVRKSRKKAKELQDKKEAEHDKMKRRIAELEGLLQSERDARRRDQDTLEQLLRNK
GPMKEQRMPQRHILENFNK
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtatagcaagctgaactacagccaccaaaagggcgaccaggccctcaagcatccacac
ctggtaagactccagcaatccgaggtacgtgggttcactgacatgccgaacaacggagct
tccacctcctccgccggatccttcgcaagacaagactctcttaccattgccgcatccctc
cagcaacgtgaccgcgaacgccatccagtggactttatggaaactgagctggaccttggc
gactacctgcaagtgctccacgatcttgacgttcctaccgacaatgtggattttgatgat
gccgagctccaaaagtgcaacatcctttacgacggagagcatccttacgaacaaccggag
ctgaacggatatgagcgccacgtggcgtacggcactggctatcgagtgcctggggattat
gatcaggatgggtacaagatgaattgtgaagtgaaagctgagacaccggatttcggagct
accaagacccgccgagctgtcaaacgcccagttccttatgacgattaccagaaggaatac
tcggaggagtccagcgatatgacggataacgacggaagcgttgacgactcctactttgag
ccaaagagcaagaaaactaaatccgccggactggaaaacttcaagccacagaccagagca
agaaagtacaaactcaaggcagacgaggagaaggctgagccgacctacaaattgaaaaga
gcccggaacaatgatgccgtcagaaaatcgcgtaaaaaggcaaaggagctccaggacaag
aaggaagccgagcacgacaagatgaagaggcgcatcgccgagcttgaagggctcctccag
tccgagcgtgacgccagacgtcgggaccaggacaccttggagcagcttctcaggaataaa
ggcccgatgaaagagcaacgcatgccccaacgccacatcctcgagaacttcaacaagtaa

DBGET integrated database retrieval system