KEGG   Caenorhabditis elegans (nematode): CELE_D1046.3Help
Entry
CELE_D1046.3      CDS       T00019                                 

Gene name
slc-25A26
Definition
(RefSeq) SLC (SoLute Carrier) homolog
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cel02000]
    CELE_D1046.3 (slc-25A26)
Transporters [BR:cel02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   CELE_D1046.3 (slc-25A26)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr Serine_protease
Motif
Other DBs
NCBI-GeneID: 177711
NCBI-ProteinID: NP_501552
WormBase: WBGene00008364
Ensembl: WBGene00008364
UniProt: Q18934
LinkDB All DBs
Position
IV:join(8930443..8930600,8931061..8931424,8931472..8931627,8932159..8932290)
Genome map
AA seq 269 aa AA seqDB search
MPSEEGSVVRWLVCGATAGLAVDIGLYPLDTIKSRMQSKQGFIAAGGFKDIYRGMISVLV
GSAPGAAIFFLTYKYINGQMKQVIEERNALVDAVSASLAEIAACAVRVPTELCKQRGQVN
KNERLTLICKEIMETKGIRGFYRGYGSTVAREIPFSIIQFPIWEALKRAVANKKESGRCS
PLEGAACGSVAGFIAAGLTTPLDVAKTRIMLTKNGPAPGILSTLKEVYTSNGVRGLYSGV
VPRVMWISGGGFVFFGAYETAMHFTKFLD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagaagaaggatcggtggtacgatggctcgtgtgtggggcgacagctggttta
gcagttgatattggattatatccattggatacaattaaatcaagaatgcaatctaaacaa
ggattcattgcagctggaggttttaaagatatttataggggaatgatctcagtattagtt
ggctcagcacccggagctgccattttcttcctcacttacaaatacattaatggacaaatg
aaacaagtaattgaagaaagaaatgctcttgtggatgctgtttctgcaagtttggctgaa
attgcagcatgtgctgtaagagtaccaacagagctttgtaagcaaagaggacaagttaat
aaaaatgaacgactgacgttaatatgcaaagaaataatggaaactaaaggaatacgtgga
ttctatcgaggatacggtagcactgtggctcgagaaattcctttttcaattatccagttt
cctatttgggaagctttgaagagggcagtggcaaataaaaaagaatcaggtcgttgtagt
ccattggaaggagctgcttgtggaagtgtagctggatttattgcagctggtttaacgaca
ccattagacgtggcaaagacacgtatcatgctcacaaaaaacggtccagctcctggtatt
ttgagcacattaaaagaggtgtacacatcaaatggagtacgtgggctttattctggagtc
gtacctcgtgtaatgtggatttcaggcggtggttttgttttcttcggtgcctatgaaaca
gcaatgcattttaccaaatttttagattag

DBGET integrated database retrieval system