KEGG   Caenorhabditis elegans (nematode): CELE_D2096.3Help
Entry
CELE_D2096.3      CDS       T00019                                 

Gene name
aagr-1
Definition
(RefSeq) Acid Alpha Glucosidase Relate
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel00052  Galactose metabolism
cel00500  Starch and sucrose metabolism
cel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CELE_D2096.3 (aagr-1)
   00500 Starch and sucrose metabolism
    CELE_D2096.3 (aagr-1)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CELE_D2096.3 (aagr-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 177632
NCBI-ProteinID: NP_501419
WormBase: WBGene00017071
Ensembl: WBGene00017071
UniProt: Q19004
LinkDB All DBs
Position
IV:join(8366754..8366918,8367467..8367569,8367910..8368149,8368197..8368294,8370325..8370541,8370592..8370842,8370900..8371019,8371065..8371262,8371310..8371612,8372033..8372280,8372325..8372438,8372486..8372627,8372894..8373136,8373294..8373358,8373402..8373477,8375120..8375347)
Genome map
AA seq 936 aa AA seqDB search
MFLKKGSTIVVLLLVFYQNTNSQSVDVSKRVDCYPEPGASQDACQSRGCIWTEAPSSSPV
GTPWCYYPTESGFTVQSTGTNSFVLAAKTKNPYGNNISPLNVKYSSNGATLLLTIGNDDR
YVPPVNFPKKPSTSTESLKFTSGTIGSSDVFSFKVTRASTGVALWDTSIGGMQFADKFIQ
IATYLPSKNIYGFGDHIHKKIRHNLDRYTTWPMFARDIGPDSGSALSTQNLYGVHPFYMC
IEADGKAHGVFILNSNAQEVETGPGPHLLYRTIGGRIDMAFFPGPTPEQVVNQYLQHIGF
PFLPAYWALGYQLCRWGYGNLDAMKTVISRNQALGIPLDVPYADIDYMNHYEDFTEGDNW
SGFPAYTQQIHAQGLHLIVIFDPAVEVDYASFQRGINADASFIEWARDDQVPHNIQDQYP
MAKNTKIMLGNVWPDRNTAFPDFLDPRNNTNAWWAGEFAQFHKTLPFDGMWIDMNEPSNF
DTGTYNTVEEQLASAKLSCPITGSDSSLDVPPYPTQAVYQRNGEYLFSKTLCMLGKTAHR
TRDFYDTKNLYGWSEARATYQAIPQVTGKRSAVISRSTFPSSGRYGGHWLGDNTARWGDL
QTSVIGVMEFNMFGVPYVGSDICGFNGVSNEELCLRWHQFGAFSPFSRDHNSEGMPDQDP
AVWPSVANAAKIALTFRYYFLPFLYSLHYNAARYGHTVIRPLFFEFPKDEETLNISEQFL
WGSALMIAPALYQGQTSVHAYFPSDTWYSLQPETYGQKMFSGFNDVNAPLSSLTPVFVRG
GFVLPRQSPGTTTTASRLSPFELLITVKTNAASSGDLYYDGGDDLIPNDDIEQHPRVHWQ
FSFTSSIAGGVLTGNCETCSTAVRPPTLDIIEILGYPSSPNFNGFKLDGSSVTLDMTKTS
YNSANQRVMISARNMISLMALKKKFTLSFTNLNVYL
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcaaaaagggatccacaattgtggttcttttgttggttttttaccaaaatacc
aattcacaatcggtagatgttagtaaaagagttgattgttatccagagcctggagcatct
caagatgcatgtcaatcaagaggatgtatttggacagaggcaccgagtagttccccagtt
ggaacaccatggtgctattacccaacagaatccggattcacagtacaatcaactggaact
aattcttttgtgttggctgccaagacaaaaaacccgtatggaaacaatatatctcctcta
aatgtaaagtattcatcaaatggagcaactcttctgcttacaattggaaatgatgatcga
tatgttccacctgtgaatttcccaaagaaaccatcaacatctacggaatctctgaagttt
acatctggaactattggatcttctgatgtttttagtttcaaagttactcgtgctagtact
ggagttgctctttgggatactagcattggtggcatgcaatttgctgataagttcattcaa
attgcaacctatcttccatcaaagaacatttatggatttggagatcacatccataagaag
attcgtcataatcttgatcgttacacaacatggccaatgtttgcccgtgacattggacca
gactctggatcagctctttccacacaaaatctatatggtgttcacccattctacatgtgc
atcgaagctgatggaaaagctcatggtgtatttattctgaactcgaatgcccaggaagtt
gaaactggtccaggaccacatttgttgtacagaacgatcggaggacgaattgacatggca
ttcttccctggaccaacaccggaacaagttgtaaatcagtatcttcaacacattggattc
ccattccttccagcttactgggcacttggatatcaactgtgccgttggggatacggtaat
ttagatgcaatgaagacagtgattagtagaaatcaagcattgggaattcctttggatgta
ccatatgcagatattgattacatgaatcattatgaagattttaccgagggtgataattgg
tctggatttccggcttacacgcagcagattcatgctcaaggacttcatcttattgttatt
ttcgacccagcagtggaggttgattatgcttcattccaaagaggtattaatgctgatgct
tccttcattgaatgggctcgtgatgatcaggttcctcataacattcaagatcaataccca
atggcaaagaatactaaaatcatgttgggaaatgtctggccagacagaaacactgccttc
ccagatttcttggatcctagaaacaatacaaatgcttggtgggctggagaatttgcacag
ttccataaaaccctacccttcgatggaatgtggattgatatgaacgagccatcaaacttc
gatacagggacttataacactgttgaagagcaacttgcaagtgctaaactttcatgtcca
atcactggatcagactcatcattagatgttccaccgtatccaacacaagcggtatatcaa
cgaaatggagaatatttgttctcgaaaactctgtgcatgcttggaaagaccgctcatcgt
acacgagacttctatgataccaaaaacttgtatggatggagtgaggcacgtgctacttat
caggctattccacaggtgaccggaaaacgatccgctgtaatctccagaagtactttccca
tcatccggaagatatggaggacattggctgggagataatactgccagatggggagattta
caaactagtgtcattggtgttatggaattcaatatgttcggtgttccatatgttggatcc
gatatttgtggatttaatggagtatccaatgaggaattgtgtttgagatggcatcagttt
ggagctttctcacctttttctagagatcacaattctgaaggaatgcctgatcaagatcca
gcagtttggccatcagttgccaatgcagccaagattgcactcacttttagatattacttt
cttccattcttatacagtctccattataacgctgctcgttacggtcacacagtcattcgt
ccattattctttgaattcccaaaagatgaggaaactttgaacatcagtgaacagttccta
tggggatctgctcttatgattgcaccggcattgtatcagggacaaacaagtgttcatgcg
tatttcccatctgacacatggtactctcttcaaccagagacttacggacaaaaaatgttc
tctggattcaatgacgtcaatgctccattgtcatcattgacacctgtattcgtgaggggt
ggatttgttttgccacgtcaatcacctggaactactacaacagcttcaagattgagccca
ttcgaattgctgattacggtcaagacgaatgcagcttcttctggagatctttactatgat
ggaggagatgacctgattccaaatgatgatattgagcagcatccaagagttcattggcaa
ttctcatttacttcatctattgctggaggtgttttgactggaaactgtgagacttgtagt
actgccgttcgcccgccaacccttgatatcatcgaaatccttggttacccgtcttcgcca
aactttaatgggttcaaacttgatggatcttctgtgacacttgacatgaccaagacttca
tataactctgcaaaccaaagagttatgatttccgctaggaatatgattagcttgatggca
ctcaagaagaagttcactttgagtttcaccaatttaaatgtgtatttgtaa

DBGET integrated database retrieval system