KEGG   Caenorhabditis elegans (nematode): CELE_EEED8.6
Entry
CELE_EEED8.6      CDS       T00019                                 

Gene name
ccpp-6
Definition
(RefSeq) Cytosolic carboxypeptidase 6
  KO
K23439  cytosolic carboxypeptidase protein 6 [EC:3.4.17.24]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_EEED8.6 (ccpp-6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cel01002]
    CELE_EEED8.6 (ccpp-6)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.24  tubulin-glutamate carboxypeptidase
     CELE_EEED8.6 (ccpp-6)
Peptidases and inhibitors [BR:cel01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   CELE_EEED8.6 (ccpp-6)
SSDB
Motif
Pfam: Peptidase_M14 Pepdidase_M14_N
Other DBs
NCBI-GeneID: 184043
NCBI-ProteinID: NP_495012
WormBase: WBGene00017136
Ensembl: WBGene00017136
UniProt: Q09296
LinkDB
Position
II:complement(join(5384204..5384376,5384426..5384547,5384928..5385052,5385351..5385437,5385716..5385827,5385940..5386181,5386235..5386448,5386503..5386600,5387028..5387152,5387236..5387317))
AA seq 459 aa
MGYVGNVSYPDTIPGQGNLVFEASFESGNLGRVDKVSCSEYDLFIRPDTLNNKYRVWFYF
ECKNASENQRAIFNIVNFSKQRTLFEMGIAAPVVKSNAQNSWARIPSRHIYYYRSSQHND
RWILSFAFIFESPDPVQFAYCIPYTYGQMQIWLNELESRKYPFFHRDLLVQTVQKRRVDL
ITIDATPDTFQGSKKMIFLTARVHPGESPSSHVMHGIIEFLVSKDDRAQKLRKVYCFKII
PMLNPDGVFLGNYRCSLMGHDLNRMWRTPSDWAHPSIYAVKNLLTQYDNNPQAQTVIYVD
LHAHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNTDVEKAGTG
RRTMGDLLSCLCYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALGEAFCRALLNFYEA
DCGLREIVLERPFKTFLPARAQKTLKKQARKVIQTVMMK
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgggctatgttggaaatgtcagctatcctgatacaattcctggtcagggaaatttggtt
tttgaagcaagttttgaatctggaaatttgggacgagtcgacaaagtttcctgttcagaa
tatgatttattcattcgacctgacactttgaataataaatatagagtttggttctatttt
gaatgcaaaaatgcatctgaaaatcagcgggcgatcttcaatattgtgaacttttcaaaa
caaagaacactattcgaaatgggaattgcagcacctgtagtcaaatcaaatgctcaaaat
agttgggctcgaatcccatctcgccatatctactactaccgtagttcccaacacaatgat
cgttggattctttcatttgctttcatatttgaatcaccagatcctgttcaatttgcatac
tgtataccgtatacttatggacaaatgcagatatggttgaatgagttggaatccagaaaa
tacccattttttcatagagatcttttggttcaaactgtgcaaaaacgtcgtgtcgacttg
ataacaattgatgcaacacctgacacattccaaggatccaagaaaatgatttttctaact
gcgcgagttcatcctggagagtcaccgagtagtcatgttatgcatggaattattgaattt
cttgtttccaaagatgatcgagcacagaagttgagaaaagtttattgtttcaaaattatt
ccaatgcttaatccagatggcgtttttctcggaaattatagatgttctctaatgggtcat
gacttgaatagaatgtggagaaccccttcagattgggctcatccttcaatttatgctgtg
aagaatttactgacgcaatatgataataatccgcaagcccaaactgtaatctacgttgat
ctacatgcccattctcagaagccaaattgttttttgtatggaaatgtgaatatgtcagct
gtcgaagaaaaatcgactttccggcagttatggcttccgcatttgctggcagatctttcc
gaagattattcgctcgagttcactcaattcaacacggatgtggagaaggctggtactggc
agaagaacgatgggagatctactttcctgcctttgctatacacttgaagtatcattcttc
tcttatcgccatacagactcttctggaaatggaatacaacattgtacgccatatcttcaa
tataaatatgaagctctcggcgaggcattttgcagagcacttctcaacttctatgaagcc
gactgtggactacgagagattgtgctcgaacgtccctttaagacttttctacccgcccgc
gcccagaaaactttgaaaaagcaagcgaggaaggtgattcagactgtgatgatgaaatga

DBGET integrated database retrieval system