KEGG   Caenorhabditis elegans (nematode): CELE_F10E9.6
Entry
CELE_F10E9.6      CDS       T00019                                 

Gene name
mig-10
Definition
(RefSeq) Abnormal cell migration protein 10
  KO
K23488  Ras-associated and pleckstrin homology domains-containing protein 1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F10E9.6 (mig-10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cel04990]
    CELE_F10E9.6 (mig-10)
Domain-containing proteins not elsewhere classified [BR:cel04990]
 Pleckstrin homology (PH) domain-containing proteins
  Other PH domain-containing proteins
   CELE_F10E9.6 (mig-10)
SSDB
Motif
Pfam: PH RA PH_11
Other DBs
NCBI-GeneID: 176168
NCBI-ProteinID: NP_001367746
WormBase: WBGene00003243
LinkDB
Position
III:join(8279108..8279181,8282109..8282358,8294037..8294160,8300350..8300445,8300570..8300730,8302014..8302178,8303145..8303315,8303367..8303451,8303855..8304670,8305127..8305273,8305321..8305571)
AA seq 779 aa
MDSCEEECDLEVDSDEEDQLFGEKCISLLSSLLPLSSSTLLSNAINLELDEVERPPPLLN
VLEEQQFPKVCANIEEENELEADTEEDIAETADDEESKDPVEKTENFEPSVTMDTYDFPD
PYPVQIRARPQVPPKPPIDTVRYSMNNIKESADWQLDELLEELEALETQLNSSNGGDQLL
LGVSGIPASSSRENVKSISTLPPPPPALSYHQTPQQPQLLHHHNNHLGYQNGIHQITSIN
SAASSCSSPDGDSAFGDSSSTESSNNRCRNSAFSSNDSCRDSLNTPSPTQVSPRNGELNA
EEAKAQKIRQALEKMKEAKVTKIFVKFFVEDGEALQLLIDERWTVADTLKQLAEKNHIAL
MEDHCIVEEYPELYIKRVYEDHEKVVENIQMWVQDSPNKLYFMRRPDKYAFISRPELYLL
TPKTSDHMEIPSGDQWTIDVKQKFVSEYFHREPVVPPEMEGFLYLKSDGRKSWKKHYFVL
RPSGLYYAPKSKKPTTKDLTCLMNLHSNQVYTGIGWEKKYKSPTPWCISIKLTALQMKRS
QFIKYICAEDEMTFKKWLVALRIAKNGAELLENYERACQIRRETLGPASSMSAASSSTAI
SEVPHSLSHHQRTPSVASSIQLSSHMMNNPTHPLSVNVRNQSPASFSVNSCQQSHPSRTS
AKLEIQYDEQPTGTIKRAPLDVLRRVSRASTSSPTIPQEESDSDEEFPAPPPVASVMRMP
PPVTPPKPCTPLTSKKAPPPPPKRSDTTKLQSASPMAPAKNDLEAALARRREKMATMEC
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggacagttgcgaagaggaatgcgatctggaagttgacagtgacgaagaagatcaactt
tttggtgaaaagtgcatttccctgctctcaagtcttctaccactttcctcgtccacactt
ttgagcaacgctattaatttggaactcgacgaagttgaacggcctcctccgttgttgaac
gtgctcgaagagcaacagtttccgaaggtttgtgctaatattgaagaggagaacgagtta
gaagccgatacagaagaggatattgctgagacggcagatgacgaagaatctaaagatcct
gtagaaaaaactgaaaatttcgagccgtctgtcaccatggacacttacgacttcccggat
ccttatccggtgcagattcgagccagaccacaggttccaccgaaaccaccaatcgacact
gttagatatagtatgaataatattaaagaatccgcagattggcagttggatgaacttctt
gaagaattggaagctcttgaaactcaactcaactctagtaatggtggagatcaactttta
cttggagtgtccgggattccagcttcttctagccgggaaaatgtgaagtcaatatccaca
ctgccacctccaccaccggctctttcttatcaccaaactccacaacaacctcaactttta
catcatcacaataatcatttgggttatcagaatggtattcatcagataacctccatcaac
tcagctgcttcatcatgctcttctccagacggtgattctgcatttggtgactcaagttca
actgaatcctccaataacagatgccgtaattcggcattctcatcgaacgactcgtgccgc
gactcgctgaacactccgagccccactcaggtctcaccaagaaatggagaattaaatgca
gaagaagcaaaagctcagaagattcgtcaggctcttgagaagatgaaggaggccaaggtg
accaagatttttgtgaaattttttgtggaagacggagaagcacttcagttgcttattgat
gaacgatggactgttgcagacactctgaaacagttggctgagaagaatcatattgcatta
atggaagaccattgtattgtggaggaataccccgaactttatataaaacgagtgtacgaa
gatcacgagaaggttgttgagaatatccaaatgtgggttcaagattcaccgaacaagctt
tatttcatgcgtcgcccggacaagtacgccttcatctctcgtcctgaactctacctcctc
actccaaaaacttctgatcacatggaaattccgtctggagatcaatggacaatcgatgtg
aaacaaaagtttgtcagtgaatatttccaccgtgaaccagtagtaccaccagagatggaa
ggatttttatatttgaaatcagatggaagaaaatcatggaaaaaacattatttcgtgtta
agaccaagtggtttgtattatgcaccaaagagtaagaaaccaacaacaaaagatttgaca
tgtctgatgaatttacactcgaatcaagtttatactggaatcggatgggagaagaaatac
aaatcaccgactccttggtgtatttcaataaaattgactgcattgcaaatgaagagaagt
caatttattaaatatatttgtgctgaggatgagatgacattcaagaaatggcttgttgca
cttagaatagctaagaatggagcagaacttcttgagaactacgaaagagcttgccaaata
agaagagaaactcttggaccagcatcaagtatgtctgctgcttcatcttcaactgctatt
tctgaagttccacatagtttgagtcatcatcagcgtacaccttctgttgcttcatcaatt
caattgagttctcatatgatgaataatccaacgcatcctttatcagtgaatgtcaggaat
cagtcaccagcttctttttcagtaaactcttgccaacaatctcatccatctcgaacgtca
gcgaaattagagattcaatacgatgagcaaccgactggaacaatcaaaagagcacctcta
gatgtgctccgtcgagtatcaagagcttccacctcgtccccaacgattccccaagaagaa
tcggattcggacgaagagtttccagcgccacctccagttgcctctgtgatgagaatgccg
ccaccagtgactccaccaaagccttgtactccattaacttctaagaaagcacctccaccg
cctccgaagagatctgacacaacaaaattgcaatcagcttcacctatggccccggcgaaa
aatgatttggaagctgcgttggcgagaaggcgtgagaaaatggcaaccatggagtgttag

DBGET integrated database retrieval system