KEGG   Caenorhabditis elegans (nematode): CELE_F13E6.6
Entry
CELE_F13E6.6      CDS       T00019                                 

Gene name
rhgf-1
Definition
(RefSeq) RHo Guanine nucleotide exchange Factor
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F13E6.6 (rhgf-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cel04131]
    CELE_F13E6.6 (rhgf-1)
Membrane trafficking [BR:cel04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    CELE_F13E6.6 (rhgf-1)
SSDB
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 C1_1 PDZ_2 Tricorn_PDZ DZR C1_2
Other DBs
NCBI-GeneID: 184419
NCBI-ProteinID: NP_509791
WormBase: WBGene00006468
UniProt: G5EFE1
LinkDB
Position
X:complement(join(10698178..10698303,10698352..10698462,10698512..10698748,10698939..10699245,10699296..10699462,10699509..10699644,10699691..10699869,10699978..10700307,10700356..10700540,10700586..10700748,10700792..10700891,10701309..10701478,10701526..10701702,10701756..10701841,10702388..10702622,10702700..10702813,10702867..10703073,10703127..10703282,10703330..10703440,10703491..10703547,10704445..10704570,10706349..10706426,10706480..10706598,10706649..10706706,10706830..10706993,10711735..10711858))
AA seq 1340 aa
MRSYEFVTNTPLKLDRHKVYLVDDVAVTRTVPLSQPLSPSTASSSYNMIERCVVVQRQPD
GFGLTVNSEFPVYVHTLKQDGAAYCAGVRQGDRIVKVNGMSVSPNNHKEVLQMISNGHNV
ALTLLGKPPDPISNISFPNQQVEQKIHIADPVLIEASSKSWRQRRNELLGQMVAEERRNV
EGLRESSQNGEKIDRALKRIVSLQSQLKQLKPESIISDSQKSLTNLNMDIDSDEEENDVV
YLPESQGGPFSNLAELKTHPAHLAVFINYLLLHGNPSSLFFYLITDAYQSAYGTAKEFRR
WAFEIFSTFIIPNSPMCIPNSNQSVIQPIDKIMCMTAEHIGDSDTDTLKRIFVPGRQRAV
TDINMYLNDFRQKKQLGGQVSESTNQLTHMVRGDMTMEHRVGEQMLFRCLEQCSNSTDFD
SCEIRTQSIISSLATVIKIVLGKTSSSSNEKMLDKFPQFMARDKPPGKSRKLPANIKNRI
QVKGHSFSINSVNTVHYCYQCRDAIWGMQPWIYFCSNCDVKVHPHCTSALTDACYPVTQS
KQKSKSRLSGLIGRSDANDDEDSGSNARHEQPNVKSTSSDSGIGGEHNMDRGLVSRSHSM
RYRVATLPQSLSEDKVSIPSSKRDRSVTPSWQRSTGYDLTPADEIDESDIGDRKSKYLER
RSLESSSRMAIDLQSVSAASSCSHHSGSVAMDDDICVRRTTTLQFSRFMDGDSDFEIETE
ATPLEQLIGWDVIRHLKPKEKKRQEVINELFHTERTHVRNLKILYHVFYKPIVTSKIVTE
ELANLLFANLEELLNLHKSMSDAMRAEVEKWRSAPPRVNGGIYGDIGVLMESMFDGEAAE
NLMRVTATFCQHQQHALEFLRTRCKREKDDAFVRFLAEAESNPVCRKLQLKDMIPVEMQR
LVKYPLLLETIAKYTTEPSEEQNCLLRTVASAKRILSAVNTAKRNAENLRRLEELQKRTD
TSPFDKEFVGHDYTNLNLTKFRLVHDGPLTCRFNRGKMIELHVVLLENMLVLFTKNSDGN
KLVLKALEPSKETRWSPILPLAPLIAKEKANDKRAFFLIFNSQYGAQIYELVAGTATERK
TWFKLMGDQIMSEKKNQAAGIDHNFDVSAQTTLDSDGVAKVNVVTHPRLVNANEITIQQP
TILEHAQPVLTPAEKLKRSDEIIIQTLITKQTILAQFLSNDDSKGNTEELEKITEVLGGL
AVVDLKQRDGKELAMSAIVHGNRLLDSINQSLNIRKEMGENGLDIYILNNQEPNVPSVPS
YKLTAIAAPLMNHLKALMQVIQDQQNELNLVKQQLYHYKKLASDVDTRDRSVSEETLTDL
GEDRKMVPKRPRLPSIQPMT
NT seq 4023 nt   +upstreamnt  +downstreamnt
atgcgatcgtacgagtttgtaaccaatacaccactcaaacttgatcggcacaaagtatac
ctcgtcgacgatgtggctgtcacaaggactgtacccttatcgcagccattatccccatca
accgcatcatccagttacaatatgatagaacgatgcgtagtagttcaacgacaaccagat
ggtttcggtctgacggtgaacagcgagtttccagtttatgtgcatactctgaaacaggat
ggagctgcttactgtgcgggtgttcgtcaaggagatcggatagtcaaggtcaatggaatg
tcggtgtcgcccaataaccataaggaagtgctccaaatgatatcgaatggccacaacgtt
gcattgactctacttggaaaaccaccggaccccatatccaatatttcttttccgaatcaa
caagttgagcaaaaaatacatatcgctgatccagtgctcatcgaggccagctcaaagagt
tggcgacaacgacgcaacgaattacttggccagatggtagctgaagaaagacgaaacgtt
gagggtctacgagagtcatctcaaaatggcgaaaaaattgacagagctttaaaacgaatt
gtttcattgcagtcacaactgaaacaattaaaaccagaatcaattatctcggatagtcag
aaaagtttgacaaatctaaacatggacattgatagtgacgaagaggaaaatgacgttgtc
tatttgcctgaatcacaaggaggcccattttctaatttggcggagctcaaaacccatcca
gcacatttggcggtgttcataaattatcttttactacacggaaatccaagtagtttgttt
ttctatctaatcaccgatgcatatcagtccgcatacggcaccgccaaagaattccgacgt
tgggcgttcgaaatattctccacattcatcattcctaattccccaatgtgtattcccaac
tcgaaccaaagcgtcattcagccgattgacaagattatgtgcatgacagctgagcatatt
ggagacagtgatactgacacattaaaacgaatatttgtgccaggacgacaaagagctgta
accgacatcaatatgtatctgaatgactttcgacagaaaaagcaactcggtgggcaggtg
tctgaatcgacgaatcaactgacgcatatggttcgaggtgacatgacaatggagcacagg
gttggagagcagatgctgttccgttgtctcgagcaatgcagtaattcgacggacttcgac
tcttgtgaaattcgtacgcagtcaataatttctagtcttgcgacagttatcaagatcgta
ttgggaaagacatcgtcgtcgtctaacgagaaaatgcttgacaagtttccgcagttcatg
gcacgcgacaagccacccggaaagagtcgcaagttgccggcaaacatcaaaaatcgcatt
caagtcaaagggcatagcttttcaatcaactcggtgaacacggttcactattgttatcaa
tgtagggatgctatctggggaatgcaaccatggatctatttttgtagcaattgtgatgtt
aaagttcatcctcactgcacatcagcacttacggatgcttgttacccggtaactcaatct
aaacaaaaatctaagtctcgtctatctggtttaattggccgttccgatgctaacgacgat
gaagactcgggaagcaatgcacggcacgagcagcctaatgtgaaatccactagctcggac
agcggaattggcggtgaacataacatggatcgtggcttggtatccagatcgcatagcatg
agatatcgcgttgcaactctcccacaatctctatctgaagataaagtttcgattccaagt
tcaaaacgagataggtcggtcacacctagttggcaacgatcaacgggatatgatttgacg
ccggctgatgaaatagacgaaagtgatattggtgacagaaaatcgaaatatcttgaaaga
agatctttggaaagctcgagtagaatggccattgatctacaaagtgtcagtgcagcttct
agttgttcacatcatagtggttccgttgctatggatgacgatatatgtgttcgacgaacc
acaactcttcaattctctagatttatggatggcgatagcgattttgaaattgaaaccgag
gcaacgccgttagaacaactgattggatgggatgttattaggcatctgaaacctaaagag
aaaaagcgtcaggaagtgataaatgaattatttcacacggagcggactcacgttaggaat
ctcaaaatattatatcatgtattttataagcctattgtcaccagcaaaattgtaactgaa
gaacttgcaaatctgttatttgccaatctagaagagctcttgaatttgcacaaaagcatg
tctgatgctatgagagcagaagttgaaaagtggagatcagcaccgcctcgtgtgaatgga
ggaatttatggggacattggtgtgctgatggagagcatgtttgatggtgaagcagccgaa
aacctgatgcgagttacggcaacgttctgtcaacaccaacaacacgcgctcgagtttctc
agaacacggtgtaaacgagaaaaagacgacgcttttgtgaggtttctagccgaggcagaa
tcgaatcccgtttgtcgtaagctacagctcaaagacatgattcccgtggaaatgcaaagg
cttgtcaaatatcctttattgctggaaaccattgcaaagtatacaaccgagcccagtgag
gaacaaaattgtttactccgaacggtagcatcagcgaaacgtattctaagtgctgtgaat
actgccaaacgaaatgctgaaaacttgagacgtcttgaagagctgcaaaaacgaacagac
acgtcgccgtttgacaaagagtttgtcgggcatgactatacgaacttgaatttaaccaaa
tttcggcttgtgcacgatggtcctttaacatgtcggtttaacagaggaaagatgatagaa
ttgcatgttgttcttcttgagaatatgctagtattgttcacaaagaacagcgatgggaac
aaactagtgcttaaggcattggaaccctcaaaggagaccagatggtcaccgattcttcca
ttagctcctctgattgctaaagaaaaagccaatgacaagcgtgcatttttcttaattttt
aatagtcagtatggtgcgcaaatttatgaactggtagcgggaacggcgacagaacgaaaa
acatggtttaaactaatgggtgaccagataatgagtgagaaaaagaaccaagctgccggt
atcgatcataactttgatgtgagtgcgcaaactacgctggattctgatggtgtggccaaa
gtaaatgtcgttacacatccaagattggtgaatgcaaatgaaattacaattcaacaaccg
accattttggagcatgcacagcccgtattaactcctgcggaaaaattaaaacgaagcgat
gagatcatcattcaaacacttatcactaaacagacaatactggctcaattcttgtcaaac
gatgactcgaaaggaaacacggaagaactcgaaaaaatcactgaagtgcttggaggtctt
gcagttgttgacttgaaacaacgagatggaaaggaacttgcaatgtctgcaatagttcat
ggaaatcggctattggatagtatcaaccaaagtcttaacattcgaaaagaaatgggagaa
aatggattagatatctatattcttaataaccaagagcctaatgtgccgtcagttccgtct
tataaactgactgctatcgccgcaccattaatgaatcatctgaaagcactaatgcaggtg
attcaggaccaacaaaatgaacttaatcttgtcaagcagcagctttaccactacaagaaa
ctcgcatctgatgtggatactcgcgacagatctgttagcgaagagactcttactgatttg
ggagaagatcgaaaaatggttccgaaacgaccaagactaccttcaattcaaccaatgaca
tag

DBGET integrated database retrieval system