KEGG   Caenorhabditis elegans (nematode): CELE_F18G5.3
Entry
CELE_F18G5.3      CDS       T00019                                 

Gene name
gpa-12
Definition
(RefSeq) Guanine nucleotide-binding protein alpha-12 subunit
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04010  MAPK signaling pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    CELE_F18G5.3 (gpa-12)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F18G5.3 (gpa-12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F18G5.3 (gpa-12)
   04031 GTP-binding proteins [BR:cel04031]
    CELE_F18G5.3 (gpa-12)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   CELE_F18G5.3 (gpa-12)
GTP-binding proteins [BR:cel04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    CELE_F18G5.3 (gpa-12)
SSDB
Motif
Pfam: G-alpha Arf MMR_HSR1 FtsK_SpoIIIE AAA_29 MCM
Other DBs
NCBI-GeneID: 181157
NCBI-ProteinID: NP_509557
WormBase: WBGene00001674
Ensembl: WBGene00001674
UniProt: Q19572
LinkDB
Position
X:join(9247017..9247103,9247150..9247278,9247328..9247428,9247699..9247828,9247872..9248017,9248074..9248179,9248229..9248420,9248741..9248917)
AA seq 355 aa
MVCCFGKKDERTKTIEKELHKERKIMRRQINLLLLGSGESGKSTFVKQMHIIHGAGEFTA
DEVRAYRQQIYQNAISAMRVLLDARNKLGIAWEDPKRQVEVEKVMRFSVGDLLKGIDFTT
FVEVAPIISDFWNDAAIRKTYEQRNLFQISDSCQYFFEHIPRIAMPDFYPTNRDILFCRK
ATRGISEHIFEINKIPFRFIDVGGQRSQRQKWFQCFTDITSILFMVASNEYDQVILEDRR
TNRVVESRSVFETIVNNRAFSNVSIILFMNKNDLLQEKVPKSDIRQYFTDFTGDHTLVRD
VQFFLVDKFEASRRDRARPFFYHFTTAVDTENIRRVFRDVRESILEQNLKTLMMQ
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggtatgctgtttcgggaaaaaagatgaaaggaccaaaacgattgaaaaagaattacac
aaagagagaaaaattatgcggcgacaaattaatttattgcttctcggatccggtgaatct
ggaaagtccacgtttgtaaaacagatgcacataattcacggggccggagaatttacagca
gacgaagttcgagcttacagacagcagatatatcagaacgcgataagtgcaatgcgggtg
ttgttagatgctaggaacaaattaggaattgcatgggaagatccaaaaagacaagtggaa
gttgaaaaagttatgagattttctgtcggcgatttattaaaaggaattgatttcaccacg
tttgttgaagtagccccaatcatcagtgatttctggaacgacgctgcgattagaaaaaca
tatgagcaaagaaacttattccaaattagtgactcctgtcagtacttctttgagcatatt
ccacgaatcgcaatgcctgatttttacccaacaaaccgtgatatccttttctgccgaaaa
gcgacacgtggcatttctgaacacattttcgagatcaacaagattccatttaggttcatt
gatgttggcggacaaagatcgcaacgtcaaaaatggtttcaatgttttacagacatcaca
agtattttgttcatggtcgccagtaacgaatacgatcaggtgattctcgaagacagacgg
acgaatcgagttgtcgaatcacggtctgtttttgagacgattgtcaacaacagagcgttc
tctaatgtctccatcatcttgttcatgaacaaaaatgatttattgcaagagaaagttccc
aaatccgatatcagacagtatttcacggatttcacaggggatcacactttagtccgagat
gttcaatttttccttgtcgacaaattcgaagcatctcgccgcgatcgtgcacgacccttc
ttttatcacttcaccactgccgtcgacactgaaaacattagaagagtgttccgagatgta
cgtgaaagtattttagagcaaaacttgaagactctcatgatgcagtaa

DBGET integrated database retrieval system