KEGG   Caenorhabditis elegans (nematode): CELE_F21C3.3
Entry
CELE_F21C3.3      CDS       T00019                                 

Symbol
hint-1
Name
(RefSeq) Histidine triad nucleotide-binding protein 1
  KO
K02503  histidine triad (HIT) family protein
Organism
cel  Caenorhabditis elegans (nematode)
Brite
KEGG Orthology (KO) [BR:cel00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cel04147]
    CELE_F21C3.3 (hint-1)
Exosome [BR:cel04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CELE_F21C3.3 (hint-1)
SSDB
Motif
Pfam: HIT DcpS_C
Other DBs
NCBI-GeneID: 184760
NCBI-ProteinID: NP_492056
WormBase: WBGene00009002
Ensembl: WBGene00009002
UniProt: P53795
LinkDB
Position
I:complement(join(7279801..7279932,7280007..7280144,7280189..7280311))
AA seq 130 aa
MSEVDKAHLAAINKDVQANDTLFGKIIRKEIPAKIIFEDDEALAFHDVSPQAPIHFLVIP
KRRIDMLENAVDSDAALIGKLMVTASKVAKQLGMANGYRVVVNNGKDGAQSVFHLHLHVL
GGRQLQWPPG
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcggaagtagataaagcccacttggcggcaattaacaaagatgttcaagccaacgac
actcttttcggaaaaataattcgaaaagagattccagcgaaaatcatttttgaagatgat
gaggctctcgcattccatgatgtctctccacaagctccaattcattttcttgtgatccct
aagcgtcgcattgatatgctcgagaatgccgttgattcggatgctgcgcttattggaaag
cttatggttactgcttcaaaggttgcaaagcagctcggcatggccaatggataccgtgtt
gttgtgaacaatggaaaagatggagctcaatcagttttccatcttcatctccacgttttg
ggaggacgtcagctccaatggccacctggataa

DBGET integrated database retrieval system