KEGG   Caenorhabditis elegans (nematode): CELE_F22A3.1
Entry
CELE_F22A3.1      CDS       T00019                                 

Gene name
ets-4
Definition
(RefSeq) Transcription factor ets-4
  KO
K09442  SAM pointed domain-containing ETS transcription factor
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F22A3.1 (ets-4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_F22A3.1 (ets-4)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    CELE_F22A3.1 (ets-4)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3
Other DBs
NCBI-GeneID: 180927
NCBI-ProteinID: NP_001359862
WormBase: WBGene00017687
Ensembl: WBGene00017687
LinkDB
Position
X:join(6519032..6519047,6519107..6519178,6519232..6519380,6519795..6519878,6519930..6519969,6520447..6520593,6520640..6520831,6520963..6521048,6521156..6521231,6521284..6521385,6521433..6521792,6521847..6521914)
AA seq 463 aa
MTAAYCETQFHGLNQFAFPFNNLEYKYGSYSSSMNGTGSVGHRWNSLSPEPHSGTESTAS
TPFVKSEFPFDDDLFGIDQVNNVKPHPMDMPCNLPIQPIEYNRRFSKDADHSTFVKNEIE
ENILNFNVNPEIAQDNGLDTQQIDIYRDLILRHLIQDISTTCAKLGLPNDFYLWSSEHGA
RWINEMCMQFNLQPPRNCSITGIDLLGMSQKDFEMILPAGGDTLHAQLQVWKTAFENYHP
PVTVQSSGMTAAENNMQSKTNWLASTNNQTNNMAAAENPNHPFFNGNGGYPNMSMSSFFQ
QGTVLPSPSNSDTSSNGSSQDMNDDDIDLHMNNSNCGFSNFFHNQGYMNSPIDAMCNGSE
GDDDERAYTRHQGTVHLWQFIRELLDQPKQYSACVRWVDRDEGTFKIESSLLLARYWGQR
KNRSQMNYDKLSRSLRQYYKKGIIQKPEKKQRLVYKFLPPYNL
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgactgctgcttattgcgagacccaatttcatggtttgaaccaattcgcgttcccgttc
aacaacttggaatacaagtacggaagttattcttcatcaatgaacggtactggctcagtc
ggtcacagatggaattctctgagcccggagccacattccggaacggagtcaaccgcaagc
actccttttgttaaaagcgagttcccatttgatgatgatctattcggaatcgaccaggta
aacaacgtcaaaccacatccgatggatatgccatgcaatcttccaatccaacccatcgag
tataaccgtcgattctcaaaggacgccgatcacagcacgtttgtgaagaatgagattgaa
gaaaacattctcaatttcaatgtcaatccggagattgcgcaagacaacggtcttgacacc
cagcaaattgacatctacagggacctgattctccgtcatctgattcaagacatcagtaca
acttgtgccaaattgggacttccaaatgatttctacctgtggtcatccgagcatggagca
cgatggatcaacgagatgtgcatgcaattcaatcttcagccgcctagaaactgttcaatc
actggtattgatttgctcggcatgagtcaaaaagatttcgaaatgattttgccggcggga
ggcgacacgttgcatgcccaactccaagtgtggaagaccgcatttgaaaactatcatcca
cccgtgaccgttcagagctccggaatgaccgctgccgaaaataacatgcagtcaaaaact
aattggctagccagcaccaacaatcaaacaaacaacatggcagctgctgagaacccgaat
catccatttttcaatggaaacggagggtatccaaacatgtcgatgagcagcttctttcaa
cagggaactgttttgccatcgccaagcaacagcgataccagcagcaatgggagcagtcaa
gacatgaatgacgatgatattgatcttcacatgaacaattcgaactgtggtttctcaaac
ttctttcacaaccagggttacatgaactcccctattgacgcaatgtgcaacggaagcgag
ggagatgacgatgagcgtgcctacactcgtcatcaaggaactgttcatctgtggcagttt
attcgtgagcttttggatcaaccaaaacagtacagtgcatgtgttcgatgggtggataga
gatgagggaacttttaaaatcgagtcttccctcctgctggctagatattggggacaacga
aaaaaccgttcacagatgaattatgacaagttgtccagaagtcttcgacagtactataag
aaaggaatcatccaaaagccggaaaagaagcagcgtttggtgtacaaattcctgcctcct
tataacttgtag

DBGET integrated database retrieval system