KEGG   Caenorhabditis elegans (nematode): CELE_F23B12.9
Entry
CELE_F23B12.9     CDS       T00019                                 

Gene name
egl-1
Definition
(RefSeq) Programmed cell death activator egl-1
  KO
K20104  programmed cell death activator egl-1 EGL-1
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:cel00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    CELE_F23B12.9 (egl-1)
SSDB
Motif
Pfam: EGL-1
Other DBs
NCBI-GeneID: 179943
NCBI-ProteinID: NP_506575
WormBase: WBGene00001170
Ensembl: WBGene00001170
UniProt: O61667
LinkDB
Structure
PDB: 
1TY4

Position
V:complement(join(14431482..14431630,14431849..14432014,14432290..14432295))
AA seq 106 aa
MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYSSSQDFSSCEDSSQFADDSGFFDDS
EISSIGYEIGSKLAAMCDDFDAQMMSYSAHASDRSLFHRLLDFFAF
NT seq 321 nt   +upstreamnt  +downstreamnt
atgctgatgctcacctttgcctcaacctcttcggatcttctaccaatgtccaacgttttt
gacgttcaatcttccgttttctacaacgaaaagaacatgttctactcctcgtctcaggac
ttctcctcgtgtgaagattcttctcaatttgccgacgactcgggattttttgatgactct
gagatcagcagcatcggctacgagatcggctccaagctagcagcaatgtgcgatgacttc
gatgctcagatgatgtcctactcggcccatgcttccgacagaagcctcttccatcgtctt
ctggactttttcgctttttaa

DBGET integrated database retrieval system