KEGG   Caenorhabditis elegans (nematode): CELE_F25C8.4Help
Entry
CELE_F25C8.4      CDS       T00019                                 

Gene name
acs-12
Definition
(RefSeq) fatty Acid CoA Synthetase family
Organism
cel  Caenorhabditis elegans (nematode)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 180375
NCBI-ProteinID: NP_508035
WormBase: WBGene00009106
Ensembl: WBGene00009106
UniProt: Q9XV68
LinkDB All DBs
Position
V:join(20904175..20904276,20904328..20904645,20904696..20904904,20904987..20905158,20905209..20905383,20905641..20906126,20907143..20907333)
Genome map
AA seq 550 aa AA seqDB search
MIIKSKLPNLDIPDKTFHDFLFHEWEKFREDVALIDNDTFAQFTFQDVMQKADFIAKSLV
YLKVEKSEVVLLVMDWSPAAIYIALGASMAGAAIQVVSPKLQAWEMQFPVKESESRFVFS
DPLGLHEIDKLMKTLNREYRIICTGSRDFANGYPIIEDLAFAAKQNLPLPKIEPDTDIVY
LPYSSGIHGKRKGIVTTHKVMVAKTMVMWNTSKHHEFRRGDTTLTMIPLHKQCGLDAILC
ALLNGLTVVTEKNFCVHTFMTCIQRYKIRAVHLTPYLMNLMMFEAENHTYNIESLEWVVT
GADAVTEELYEEFTEIFPSVKTVTQTYGMTEVGLICRTYNKNYSPSCGQLTANLEMKVLD
ILTGKELGPREKGQICVKGIAAESPYLNNPKATEEHFLDGWRRTGDIGFFDEEGNVHLVD
KLKEMIKVFGYQVIPKEIETLLLTHQAVEEAAVVAINNELSGERPVAFVVLKKGFVATED
DLKDYVNKRVIRYKHLVRVNITQFLPKSACGTLLRRLLAEAAVMSVASIAEVEKEFVPEL
PADMKSILTH
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgattatcaaatcgaagctaccaaatttggatattccggataagacatttcacgatttc
ttgttccatgaatgggaaaaatttcgcgaagacgtggcgttaattgacaatgacacattt
gctcagttcacgtttcaagatgtaatgcaaaaggcagacttcattgccaaaagtttggta
tatctgaaagttgaaaaaagtgaagttgttctgcttgtgatggattggtctccagcagcc
atatatattgcgttgggagcatcaatggctggtgctgcaatccaggttgtcagtccgaag
ttgcaagcatgggaaatgcaatttccagttaaagagagtgaatcgagatttgtgttctct
gatccactcggccttcatgaaattgacaaattgatgaaaactctgaaccgagaatataga
attatctgcacaggaagccgcgactttgcaaacggctatccaattattgaagatctggct
tttgcagctaaacagaatcttccattgccgaaaattgaaccggacactgatattgtatac
ttaccatactcaagtggtattcacgggaaaagaaaagggatagttacaacacacaaagtc
atggttgcaaaaacaatggtaatgtggaatacttccaaacatcatgaatttcgccgtggg
gatactacacttacaatgattcctcttcacaaacaatgtggtcttgatgcaattttatgt
gcactgctaaatggactaacagtagtgacagagaaaaatttttgtgtacacacttttatg
acgtgcattcaaagatataagattcgagcagttcatctaactccttacttgatgaactta
atgatgttcgaagcggagaaccatacatacaacatcgaatcattggaatgggtggtcact
ggagccgacgctgttactgaagagctgtacgaggagtttacagaaatatttccatccgta
aaaacggtgactcaaacatatggcatgacagaagttggcctgatatgtcgaacatacaac
aaaaactattcaccatcctgcgggcagttaacagcaaatctggaaatgaaagttttggac
atcttaactggaaaagagttgggacccagagaaaaaggacaaatttgcgttaaaggaata
gctgcagaaagcccgtatttaaacaatccaaaagcaacagaagagcactttctggatggt
tggaggagaactggagatattggattctttgatgaagaaggaaatgttcacttggtggat
aagctgaaagaaatgataaaagtgttcggatatcaagtgattcccaaggagatagaaaca
cttttactcactcatcaagctgtagaggaagctgcagttgttgcaatcaacaatgaattg
agtggagagagacctgttgcatttgtggtattgaaaaaaggatttgtggcaaccgaagac
gatttaaaggattacgttaacaaacgagttatccgatacaaacatttggtccgcgtgaat
atcacccaattccttccaaaatccgcatgcggtactctacttcgtcgtctattagcagaa
gctgcagtaatgtcagtcgcttctattgccgaggtagaaaaagaatttgtgccagaactc
ccagcagacatgaaatccattttgactcattaa

DBGET integrated database retrieval system