KEGG   Caenorhabditis elegans (nematode): CELE_F29G9.4
Entry
CELE_F29G9.4      CDS       T00019                                 

Gene name
fos-1
Definition
(RefSeq) Transcription factor fos-1
  KO
K09031  fos-like antigen, invertebrate
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel04361  Axon regeneration
Brite
KEGG Orthology (KO) [BR:cel00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    CELE_F29G9.4 (fos-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cel03000]
    CELE_F29G9.4 (fos-1)
Transcription factors [BR:cel03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    CELE_F29G9.4 (fos-1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 178987
NCBI-ProteinID: NP_001033481
WormBase: WBGene00001345
Ensembl: WBGene00001345
UniProt: G5ECG2
LinkDB
Position
V:join(6008566..6008823,6011101..6011170,6011216..6011352,6013510..6013623,6014219..6014719,6014773..6014974,6015570..6015691)
AA seq 467 aa
MFEQPSSTTNTTTSSGSGSDSNHYFELGPRNPINQAHPTSVIVPPRQHHHQIHQQQTDNS
PLTPCTPYYPSNAYGLPLFFGTDFLQFQPSDIPSPLTPNISSPLTPHPFGPIPAIPTNQI
YNRTFTDFYSTAASSPMVQYSTVKKSSAGRKPKEEDNMEDDDDDKRLKRRQRNKEAAARC
RQRRIDLMKELQDQVNDFKNSNDKKMAECNNIRNKLNSLKNYLETHDCKLSREERTHEIN
RLIIPPSTVPPSQPYLQHSLRVHPPRADSVPYSIRSGHSSSSSEQHSPVEDYKPSIDQLL
LPPISCIQNIKDRNINSMPPPALPASTSAAGIHVITSIPVSHANSLHGRSENVFAEPERK
IPKIELDQTLTSLTMPDDVERPSALPTLSRIVENQPITTPSRPFRLGGEYQNQTPQSTGN
GLFGGPPGPFDLLSSNTGLTPSGQPTMNFVSTPTPIQPHPDADLRPL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgttcgaacaaccatcgtcgacgactaacaccaccacgagctctggttctggctccgat
tccaatcactacttcgaattgggtcccaggaacccgatcaaccaagcgcacccgacatca
gtcattgttccaccgcgacaacatcaccatcagatccaccaacaacaaaccgacaactca
cctctaactccgtgtacaccatattatccatcaaatgcatatggactccctttattcttt
ggaactgatttcctgcagttccaaccatctgatatcccatctccgctcacaccgaacatc
agctcgccacttacgccacatccatttggtccgatcccagcaatcccgactaatcaaatc
tacaatcgaacattcaccgatttctactcgacggcagcttcatcgcctatggtacagtat
agcacggtgaagaaatcgtcggctgggagaaaacctaaagaagaggataatatggaggat
gacgatgatgataagaggctgaaacgtcgtcaaaggaataaagaagctgctgcaagatgt
cggcaaaggagaattgatttgatgaaggaattgcaagatcaagtaaatgacttcaaaaat
agcaacgacaaaaaaatggcggaatgcaacaacatccgaaataagctcaacagtctcaaa
aactatttggaaacgcatgattgtaaactgagtcgcgaagaacgaacacatgagataaat
cgattgataatcccaccatcaacagttccaccatcacaaccatatcttcaacattcgttg
agagttcatccaccacgtgctgactctgtaccatattctattcgatcaggacattcatct
tcatcgtctgaacaacactcaccagttgaggactataagccttcaattgatcaattactt
cttcctccaatctcatgtattcaaaatatcaaagatcgaaatatcaattctatgccacca
ccagctttaccggcaagcacgagtgctgctggaattcatgttatcacttctatcccggtt
tcgcatgccaactcattacacggtcgttcggaaaacgttttcgcagaaccggaacgcaaa
attccaaaaatcgagttggaccaaacactgacatcattgaccatgccagacgacgttgaa
cgtccgtcagctcttccgacgctttccagaatcgttgaaaatcagccgatcactactccc
agcaggcctttccgtctcgggggggaatatcaaaatcaaacaccgcagagtacagggaat
ggactattcggaggcccaccaggcccattcgacttgctttcctccaacactggtctgaca
ccttctggtcagccaacaatgaacttcgtttcaactccaaccccgattcaaccacatccg
gatgctgatctccgaccactctag

DBGET integrated database retrieval system