KEGG   Caenorhabditis elegans (nematode): CELE_F31E3.4Help
Entry
CELE_F31E3.4      CDS       T00019                                 

Gene name
panl-2
Definition
(RefSeq) PAN (PolyA-specific riboNucLease) subunit
  KO
K12571  PAB-dependent poly(A)-specific ribonuclease subunit 2 [EC:3.1.13.4]
Organism
cel  Caenorhabditis elegans (nematode)
Pathway
cel03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cel00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CELE_F31E3.4 (panl-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cel03019]
    CELE_F31E3.4 (panl-2)
Enzymes [BR:cel01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.4  poly(A)-specific ribonuclease
     CELE_F31E3.4 (panl-2)
Messenger RNA biogenesis [BR:cel03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     CELE_F31E3.4 (panl-2)
  mRNA degradation factors
   3'-5' decay
    Pan complex
     CELE_F31E3.4 (panl-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T UCH_1 WD40_like BING4CT zf-CCCH_2 DNA_pol_A_exo1
Motif
Other DBs
NCBI-GeneID: 175974
NCBI-ProteinID: NP_498519
WormBase: WBGene00017951
Ensembl: WBGene00017951
UniProt: P53015
LinkDB All DBs
Position
III:complement(join(6963913..6964151,6964216..6964309,6964355..6964508,6964556..6964707,6964779..6965343,6965393..6965607,6965653..6965861,6965918..6966528,6966573..6966697,6966757..6966836,6966882..6967198,6967245..6967363,6967415..6967619,6967666..6967838,6967890..6967994,6968045..6968077))
Genome map
AA seq 1131 aa AA seqDB search
MASATTNQGNEWRFVAPININTTTENTVSCVKFDPHEDLFWIGSSTGKVTSLLPTNHFTR
YSAFVVSNISGVHSLEPTESLIFTLSDTMLRATTRQGIPVAKFTSPSMTKMAASCHMPGT
STFIMGGFQEKLIHYDFVKEKEIRTTELKASENAIIIRYNGTNTFTADTRGNVFVKNSKN
CETIHTLDCHQDQVLDFDVQGNKLITCGVSMNRLKNMDQFIKVYDLRMYKALSPIGMPYL
PQFARFMPSYCERVCVTYQTMYNQPGQTATWSNHPAGVKMFDLNSNGNSAEFPIETSLIS
AFDFSSNKNFIAVGNHCGIVNVFADRDQPQVNENSKETVFAAPPVQPPLSFAIDDTTQTF
GSIPLGFSQEPLVSDWPTELTQIVYRRRKPPTEQTNVKSIHYLSQIKNPRINSKLKRHNI
VPYFFEQEELIEASNDHGSKEEAPQEMKRIKVSKLYKKRPLIVNQVPARRGNSQDETQET
YTWNIIRHVTMQSTHGMNLVANTLVQVAYSLSPIRSIVLRHICTEDSCITCELHFLFTAF
SSKIGDNSGMLTNNLAWALARNGVSLKAGGVLSATQQIIKTVIDDVARTDASGSICSKFD
RHLRCIRCRGLQQQESVTDHLLKLNYAPVYQASLCQLIEKSLHIGDDSGEIECEDCKQMS
RMECKRKVRELSPVLLIDTNASSNGFVEFWRRQLSLFERKPGGNRSSALGTVPESPSEKK
NCRFGTDCRNKKTCKFVHGLVDWPAEQTKLLEDVDLPEWAHYIPSRIAAQLCEGIVRLSD
VSDLPDYDEPSAVIYELDAMIHAVGNGENDVNWTHPVTLLRESPVISSSWTLINEQLVSR
LHDHEARHIDGRWKLPALLAYKKKNFDVKTSEDIISNDLFLAEENLASNGMTSLAVQSLE
ELPKEKELVGLDAEFIKIKTDLLEFDGKTVQMRAVGRASCVDSTGERIIFDDHVKLTDDV
EVVDYLTKFSGIVKADLCPTTSEKYLTTHKRLLLRMHVLIQRGVTFVGHALHNDFTVLNV
HVAESQIIDTVTLMRLGTQRMLSLQFLVKEILGETIQMEAHDSVVDARYALKLYRKYLEI
KEQGLLGSEMRRIYTILPCPSPNQTSSPLVVSTTRKTPEDTNPADAAPKSV
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggcaactactaaccaaggaaatgagtggcgatttgtggcgccgatcaatatc
aacacgaccactgaaaatactgtatcatgtgtaaaatttgacccacatgaagatttattt
tggataggatcttctacgggaaaagtgacatctctgctacccaccaaccacttcacacgt
tattccgcgttcgtcgtatcgaacattagcggggttcacagtctagagcctactgaaagt
ttgattttcacattgagtgatacaatgctgcgcgcaacgacgcggcaaggaattccagtg
gcgaagtttacatcaccatcaatgacaaaaatggcagcttcttgtcacatgcccggaacg
tcaacgtttataatgggaggatttcaagagaagctgattcactatgattttgtgaaagag
aaagaaattcgaaccactgaactgaaggcatcggaaaatgccattattatcagatataat
ggcacaaacacgttcaccgctgacacgagaggaaacgtttttgtgaaaaactcgaaaaat
tgcgaaacgatccacacactagactgtcatcaggaccaagttctagattttgatgtacaa
ggcaacaagttgatcacatgcggagtttcaatgaatcgtctaaagaacatggatcagttc
ataaaagtttacgatctccgaatgtacaaggcgttgagtccgattggaatgccctatcta
ccacagttcgcaagatttatgccgtcttactgtgaacgcgtctgtgttacatatcaaacg
atgtacaatcagcctggccagactgcaacttggtcgaatcatcctgccggtgtcaaaatg
tttgatttgaattcaaatggaaatagtgccgaattccctatcgagacgtctttaatatcg
gcattcgatttttcatcgaataaaaatttcattgccgtcggaaatcactgtggaatagtc
aacgttttcgccgatcgagatcagccacaagttaatgaaaactcaaaggagacggttttc
gccgcaccaccggtccagccacctctctcattcgctatcgacgacactacacaaacgttt
ggttcgattcctctaggattttcacaagaaccacttgttagtgattggccgacagaattg
acgcaaattgtgtataggcgacgaaagcctcctactgaacagacgaatgtaaaatcgatt
cattatttgtcacaaataaaaaatccccgaattaattcgaagctgaagcgccacaatatt
gttccttactttttcgagcaggaggaactgattgaagcatccaacgatcatggatctaag
gaagaagctccacaggaaatgaagagaattaaagtttcaaaactgtacaagaagcgccct
ctaattgtcaatcaagtaccggctagacgtggaaactctcaagacgagacgcaagagaca
tacacgtggaacatcattcgacatgtaacaatgcagtcaacacatggaatgaatctagtg
gctaacactcttgtccaagttgcatactcgttgtcaccaattcgtagcatcgttttacgt
catatctgcacagaagactcatgtatcacctgcgagcttcactttctcttcactgcattt
tcatcaaaaattggggacaacagtggaatgctgacaaacaatttggcttgggctcttgca
cgaaatggagttagcttgaaggctggaggagtattgagtgctacacagcaaatcatcaag
acagtgatcgatgatgtcgctcgaacagatgcttcgggttcaatttgctcaaagttcgat
cgtcatctccgatgtattcgttgtcggggactccagcagcaagaatctgtcacggatcat
cttctcaaactaaactatgctccagtttatcaagcatcgctttgccaacttattgaaaag
tcattgcatatcggagatgattctggagaaattgagtgtgaagactgcaagcagatgagc
cgaatggagtgtaagagaaaagttcgggagctctcccccgttcttctaattgacacaaac
gcttcatcgaatggatttgttgagttttggcgtcggcaattatctctctttgaacgaaaa
ccaggaggcaatcgaagttctgcattaggaacggtgccagagtcaccttctgagaagaaa
aattgcagatttggaacggattgtcgcaacaagaaaacatgcaagtttgttcatggactc
gtcgattggcctgcagaacagacaaaacttcttgaagacgtggatttaccagagtgggca
cactacattccatccagaatcgctgctcaactttgcgaggggattgttcgtttgtctgat
gtttcggatctcccagactatgatgagccgtctgctgtgatttatgagcttgatgcgatg
attcatgctgttggtaatggagaaaacgatgtaaattggactcatccagttacattgttg
agagaaagtcccgttatttcatcgtcctggactttaatcaatgagcagctagtgagccga
ttgcatgatcatgaagcaaggcacatagacggaagatggaaacttcccgcgcttttggct
tataaaaagaagaacttcgatgtgaaaacgagtgaggatattatttccaatgatttgttc
ctcgcggaagaaaatttggcgagcaacgggatgacgtcattggccgttcaatcattggaa
gagctgccgaaagagaaggaattagtcggtttggatgcagagtttataaagattaagacc
gatctacttgaattcgacggaaaaaccgtgcagatgagagcagttggtcgagcctcctgt
gtcgactcgacaggcgaaaggatcatattcgacgatcacgtgaagctcactgatgacgta
gaagttgtcgactatctcacgaagtttagtggaatcgtgaaagctgatctgtgtccaacg
acttccgagaaatacttgacaacccacaagcggcttcttctacgaatgcatgttttgatt
caacgaggagtcacatttgtaggacacgctctgcataatgatttcacagtgctcaatgtg
catgtggcagaatcacagataatcgacacagtgactctgatgcgtcttggcacccagaga
atgttatcattgcagtttctggttaaggagattcttggcgaaactatacaaatggaagct
cacgactcggtggttgatgcgagatatgcactgaagctgtaccgaaaatatctggaaatc
aaagagcaaggacttctgggttcagaaatgcgtcgaatctacactattctcccgtgtcca
tcgccaaaccaaacatcgtcacctctggttgtatctactacacgaaaaactccagaagat
acgaatccagcagatgctgcaccgaagtcggtttaa

DBGET integrated database retrieval system